data_1G1T # _entry.id 1G1T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1G1T RCSB RCSB012127 WWPDB D_1000012127 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1G1Q 'Crystal structure of P-selectin lectin/EGF domains' unspecified PDB 1G1R 'Crystal structure of P-selectin lectin/EGF domains complexed with SLeX' unspecified PDB 1G1S 'Crystal structure of P-selectin lectin/EGF domains' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G1T _pdbx_database_status.recvd_initial_deposition_date 2000-10-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Somers, W.S.' 1 'Camphausen, R.T.' 2 # _citation.id primary _citation.title ;Insights into the molecular basis of leukocyte tethering and rolling revealed by structures of P- and E-selectin bound to SLe(X) and PSGL-1. ; _citation.journal_abbrev 'Cell(Cambridge,Mass.)' _citation.journal_volume 103 _citation.page_first 467 _citation.page_last 479 _citation.year 2000 _citation.journal_id_ASTM CELLB5 _citation.country US _citation.journal_id_ISSN 0092-8674 _citation.journal_id_CSD 0998 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11081633 _citation.pdbx_database_id_DOI '10.1016/S0092-8674(00)00138-0' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Somers, W.S.' 1 ? primary 'Tang, J.' 2 ? primary 'Shaw, G.D.' 3 ? primary 'Camphausen, R.T.' 4 ? # _cell.entry_id 1G1T _cell.length_a 34.506 _cell.length_b 72.387 _cell.length_c 77.576 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G1T _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting orthorhombic _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man E-SELECTIN 18103.234 1 ? ? 'LECTIN/EGF DOMAINS' ? 2 branched man ;N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galactopyranose-(1-4)-[alpha-L-fucopyranose-(1-3)]methyl 2-acetamido-2-deoxy-beta-D-glucopyranoside ; 834.770 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 water nat water 18.015 186 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ENDOTHELIAL LEUKOCYTE ADHESION MOLECULE 1, ELAM-1, LEUKOCYTE-ENDOTHELIAL CELL ADHESION MOLECULE 2, LECAM2, CD62E' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIV ; _entity_poly.pdbx_seq_one_letter_code_can ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 SER n 1 3 TYR n 1 4 ASN n 1 5 THR n 1 6 SER n 1 7 THR n 1 8 GLU n 1 9 ALA n 1 10 MET n 1 11 THR n 1 12 TYR n 1 13 ASP n 1 14 GLU n 1 15 ALA n 1 16 SER n 1 17 ALA n 1 18 TYR n 1 19 CYS n 1 20 GLN n 1 21 GLN n 1 22 ARG n 1 23 TYR n 1 24 THR n 1 25 HIS n 1 26 LEU n 1 27 VAL n 1 28 ALA n 1 29 ILE n 1 30 GLN n 1 31 ASN n 1 32 LYS n 1 33 GLU n 1 34 GLU n 1 35 ILE n 1 36 GLU n 1 37 TYR n 1 38 LEU n 1 39 ASN n 1 40 SER n 1 41 ILE n 1 42 LEU n 1 43 SER n 1 44 TYR n 1 45 SER n 1 46 PRO n 1 47 SER n 1 48 TYR n 1 49 TYR n 1 50 TRP n 1 51 ILE n 1 52 GLY n 1 53 ILE n 1 54 ARG n 1 55 LYS n 1 56 VAL n 1 57 ASN n 1 58 ASN n 1 59 VAL n 1 60 TRP n 1 61 VAL n 1 62 TRP n 1 63 VAL n 1 64 GLY n 1 65 THR n 1 66 GLN n 1 67 LYS n 1 68 PRO n 1 69 LEU n 1 70 THR n 1 71 GLU n 1 72 GLU n 1 73 ALA n 1 74 LYS n 1 75 ASN n 1 76 TRP n 1 77 ALA n 1 78 PRO n 1 79 GLY n 1 80 GLU n 1 81 PRO n 1 82 ASN n 1 83 ASN n 1 84 ARG n 1 85 GLN n 1 86 LYS n 1 87 ASP n 1 88 GLU n 1 89 ASP n 1 90 CYS n 1 91 VAL n 1 92 GLU n 1 93 ILE n 1 94 TYR n 1 95 ILE n 1 96 LYS n 1 97 ARG n 1 98 GLU n 1 99 LYS n 1 100 ASP n 1 101 VAL n 1 102 GLY n 1 103 MET n 1 104 TRP n 1 105 ASN n 1 106 ASP n 1 107 GLU n 1 108 ARG n 1 109 CYS n 1 110 SER n 1 111 LYS n 1 112 LYS n 1 113 LYS n 1 114 LEU n 1 115 ALA n 1 116 LEU n 1 117 CYS n 1 118 TYR n 1 119 THR n 1 120 ALA n 1 121 ALA n 1 122 CYS n 1 123 THR n 1 124 ASN n 1 125 THR n 1 126 SER n 1 127 CYS n 1 128 SER n 1 129 GLY n 1 130 HIS n 1 131 GLY n 1 132 GLU n 1 133 CYS n 1 134 VAL n 1 135 GLU n 1 136 THR n 1 137 ILE n 1 138 ASN n 1 139 ASN n 1 140 TYR n 1 141 THR n 1 142 CYS n 1 143 LYS n 1 144 CYS n 1 145 ASP n 1 146 PRO n 1 147 GLY n 1 148 PHE n 1 149 SER n 1 150 GLY n 1 151 LEU n 1 152 LYS n 1 153 CYS n 1 154 GLU n 1 155 GLN n 1 156 ILE n 1 157 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Chinese hamster' _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus Cricetulus _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'ovary [CHO] cells' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code LEM2_HUMAN _struct_ref.pdbx_db_accession P16581 _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_seq_one_letter_code ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIV ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G1T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 157 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16581 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 157 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose ? 'C6 H12 O5' 164.156 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAG D-saccharide n 'methyl 2-acetamido-2-deoxy-beta-D-glucopyranoside' ? 'C9 H17 N O6' 235.234 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SIA 'D-saccharide, alpha linking' . 'N-acetyl-alpha-neuraminic acid' ? 'C11 H19 N O9' 309.270 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1G1T _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.68 _exptl_crystal.density_percent_sol 54.02 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'HEPES, Tris-HCl, CaCl2, PEG 4000, pH 7.5, VAPOR DIFFUSION, HANGING DROP at 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IV' _diffrn_detector.pdbx_collection_date 1997-01-01 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Mirrors _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RU200' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1G1T _reflns.observed_criterion_sigma_I 3 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15 _reflns.d_resolution_high 1.50 _reflns.number_obs 29493 _reflns.number_all 29493 _reflns.percent_possible_obs 92.4 _reflns.pdbx_Rmerge_I_obs 0.041 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 47.6 _reflns.B_iso_Wilson_estimate 20 _reflns.pdbx_redundancy 8.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.55 _reflns_shell.percent_possible_all 62 _reflns_shell.Rmerge_I_obs 0.22 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 8.8 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1G1T _refine.ls_number_reflns_obs 29493 _refine.ls_number_reflns_all 29493 _refine.pdbx_ls_sigma_I 0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 15.0 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.196 _refine.ls_R_factor_all 0.196 _refine.ls_R_factor_R_work 0.196 _refine.ls_R_factor_R_free 0.217 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5 _refine.ls_number_reflns_R_free 1474 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1266 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 58 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 1510 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 15.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.009 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.42 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1G1T _struct.title 'CRYSTAL STRUCTURE OF E-SELECTIN LECTIN/EGF DOMAINS COMPLEXED WITH SLEX' _struct.pdbx_descriptor 'E-SELECTIN, SACCHARIDE COMPLEX' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1G1T _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM, MEMBRANE PROTEIN' _struct_keywords.text 'Lectin, EGF, Adhesion molecule, SLeX, IMMUNE SYSTEM, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? TYR A 23 ? THR A 11 TYR A 23 1 ? 13 HELX_P HELX_P2 2 ASN A 31 ? LEU A 42 ? ASN A 31 LEU A 42 1 ? 12 HELX_P HELX_P3 3 THR A 125 ? GLY A 129 ? THR A 125 GLY A 129 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 19 A CYS 117 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 90 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 90 A CYS 109 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 133 SG ? ? A CYS 122 A CYS 133 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf4 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 127 A CYS 142 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf5 disulf ? ? A CYS 144 SG ? ? ? 1_555 A CYS 153 SG ? ? A CYS 144 A CYS 153 1_555 ? ? ? ? ? ? ? 2.034 ? ? covale1 covale both ? B MAG . O4 ? ? ? 1_555 B GAL . C1 ? ? B MAG 1 B GAL 2 1_555 ? ? ? ? ? ? ? 1.425 ? ? covale2 covale both ? B MAG . O3 ? ? ? 1_555 B FUC . C1 ? ? B MAG 1 B FUC 4 1_555 ? ? ? ? ? ? ? 1.432 ? ? covale3 covale both ? B GAL . O3 ? ? ? 1_555 B SIA . C2 ? ? B GAL 2 B SIA 3 1_555 ? ? ? ? ? ? ? 1.443 ? ? metalc1 metalc ? ? A GLU 80 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 80 A CA 160 1_555 ? ? ? ? ? ? ? 2.563 ? ? metalc2 metalc ? ? A ASN 82 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 82 A CA 160 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc3 metalc ? ? A ASN 83 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 83 A CA 160 1_555 ? ? ? ? ? ? ? 2.354 ? ? metalc4 metalc ? ? A ASN 105 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 105 A CA 160 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc5 metalc ? ? A ASP 106 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 106 A CA 160 1_555 ? ? ? ? ? ? ? 2.353 ? ? metalc6 metalc ? ? A ASP 106 O ? ? ? 1_555 C CA . CA ? ? A ASP 106 A CA 160 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 B FUC . O3 ? ? A CA 160 B FUC 4 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 B FUC . O4 ? ? A CA 160 B FUC 4 1_555 ? ? ? ? ? ? ? 2.587 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 80 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 80 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 81 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 81 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 5 ? C ? 2 ? D ? 2 ? E ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel E 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 2 ? THR A 5 ? SER A 2 THR A 5 A 2 LEU A 114 ? THR A 119 ? LEU A 114 THR A 119 A 3 HIS A 25 ? LEU A 26 ? HIS A 25 LEU A 26 B 1 SER A 2 ? THR A 5 ? SER A 2 THR A 5 B 2 LEU A 114 ? THR A 119 ? LEU A 114 THR A 119 B 3 TYR A 49 ? ILE A 51 ? TYR A 49 ILE A 51 B 4 CYS A 90 ? ILE A 93 ? CYS A 90 ILE A 93 B 5 TRP A 104 ? GLU A 107 ? TRP A 104 GLU A 107 C 1 ILE A 53 ? VAL A 56 ? ILE A 53 VAL A 56 C 2 VAL A 59 ? TRP A 62 ? VAL A 59 TRP A 62 D 1 GLY A 131 ? THR A 136 ? GLY A 131 THR A 136 D 2 ASN A 139 ? CYS A 144 ? ASN A 139 CYS A 144 E 1 PHE A 148 ? SER A 149 ? PHE A 148 SER A 149 E 2 GLN A 155 ? ILE A 156 ? GLN A 155 ILE A 156 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 4 ? O ASN A 4 N CYS A 117 ? N CYS A 117 A 2 3 N TYR A 118 ? N TYR A 118 O HIS A 25 ? O HIS A 25 B 1 2 O ASN A 4 ? O ASN A 4 N CYS A 117 ? N CYS A 117 B 2 3 O LEU A 114 ? O LEU A 114 N TRP A 50 ? N TRP A 50 B 3 4 N ILE A 51 ? N ILE A 51 O VAL A 91 ? O VAL A 91 B 4 5 N GLU A 92 ? N GLU A 92 O ASN A 105 ? O ASN A 105 C 1 2 N VAL A 56 ? N VAL A 56 O VAL A 59 ? O VAL A 59 D 1 2 N THR A 136 ? N THR A 136 O ASN A 139 ? O ASN A 139 E 1 2 O SER A 149 ? O SER A 149 N GLN A 155 ? N GLN A 155 # _database_PDB_matrix.entry_id 1G1T _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1G1T _atom_sites.fract_transf_matrix[1][1] 0.028980 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013815 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012891 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 1 1 TRP TRP A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 CYS 142 142 142 CYS CYS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 VAL 157 157 157 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 160 160 CA CA A . D 4 HOH 1 162 162 HOH HOH A . D 4 HOH 2 180 180 HOH HOH A . D 4 HOH 3 181 181 HOH HOH A . D 4 HOH 4 203 203 HOH HOH A . D 4 HOH 5 204 204 HOH HOH A . D 4 HOH 6 205 205 HOH HOH A . D 4 HOH 7 207 207 HOH HOH A . D 4 HOH 8 208 208 HOH HOH A . D 4 HOH 9 212 212 HOH HOH A . D 4 HOH 10 214 214 HOH HOH A . D 4 HOH 11 218 218 HOH HOH A . D 4 HOH 12 220 220 HOH HOH A . D 4 HOH 13 222 222 HOH HOH A . D 4 HOH 14 223 223 HOH HOH A . D 4 HOH 15 224 224 HOH HOH A . D 4 HOH 16 225 225 HOH HOH A . D 4 HOH 17 227 227 HOH HOH A . D 4 HOH 18 228 228 HOH HOH A . D 4 HOH 19 230 230 HOH HOH A . D 4 HOH 20 232 232 HOH HOH A . D 4 HOH 21 234 234 HOH HOH A . D 4 HOH 22 236 236 HOH HOH A . D 4 HOH 23 237 237 HOH HOH A . D 4 HOH 24 239 239 HOH HOH A . D 4 HOH 25 240 240 HOH HOH A . D 4 HOH 26 241 241 HOH HOH A . D 4 HOH 27 244 244 HOH HOH A . D 4 HOH 28 246 246 HOH HOH A . D 4 HOH 29 251 251 HOH HOH A . D 4 HOH 30 253 253 HOH HOH A . D 4 HOH 31 254 254 HOH HOH A . D 4 HOH 32 255 255 HOH HOH A . D 4 HOH 33 257 257 HOH HOH A . D 4 HOH 34 259 259 HOH HOH A . D 4 HOH 35 260 260 HOH HOH A . D 4 HOH 36 261 261 HOH HOH A . D 4 HOH 37 262 262 HOH HOH A . D 4 HOH 38 264 264 HOH HOH A . D 4 HOH 39 265 265 HOH HOH A . D 4 HOH 40 267 267 HOH HOH A . D 4 HOH 41 268 268 HOH HOH A . D 4 HOH 42 269 269 HOH HOH A . D 4 HOH 43 270 270 HOH HOH A . D 4 HOH 44 271 271 HOH HOH A . D 4 HOH 45 272 272 HOH HOH A . D 4 HOH 46 274 274 HOH HOH A . D 4 HOH 47 275 275 HOH HOH A . D 4 HOH 48 276 276 HOH HOH A . D 4 HOH 49 279 279 HOH HOH A . D 4 HOH 50 280 280 HOH HOH A . D 4 HOH 51 281 281 HOH HOH A . D 4 HOH 52 282 282 HOH HOH A . D 4 HOH 53 283 283 HOH HOH A . D 4 HOH 54 289 289 HOH HOH A . D 4 HOH 55 298 298 HOH HOH A . D 4 HOH 56 299 299 HOH HOH A . D 4 HOH 57 300 300 HOH HOH A . D 4 HOH 58 301 301 HOH HOH A . D 4 HOH 59 303 303 HOH HOH A . D 4 HOH 60 306 306 HOH HOH A . D 4 HOH 61 308 308 HOH HOH A . D 4 HOH 62 309 309 HOH HOH A . D 4 HOH 63 312 312 HOH HOH A . D 4 HOH 64 313 313 HOH HOH A . D 4 HOH 65 320 320 HOH HOH A . D 4 HOH 66 321 321 HOH HOH A . D 4 HOH 67 322 322 HOH HOH A . D 4 HOH 68 323 323 HOH HOH A . D 4 HOH 69 324 324 HOH HOH A . D 4 HOH 70 326 326 HOH HOH A . D 4 HOH 71 327 327 HOH HOH A . D 4 HOH 72 328 328 HOH HOH A . D 4 HOH 73 329 329 HOH HOH A . D 4 HOH 74 330 330 HOH HOH A . D 4 HOH 75 331 331 HOH HOH A . D 4 HOH 76 332 332 HOH HOH A . D 4 HOH 77 333 333 HOH HOH A . D 4 HOH 78 334 334 HOH HOH A . D 4 HOH 79 335 335 HOH HOH A . D 4 HOH 80 336 336 HOH HOH A . D 4 HOH 81 337 337 HOH HOH A . D 4 HOH 82 339 339 HOH HOH A . D 4 HOH 83 340 340 HOH HOH A . D 4 HOH 84 341 341 HOH HOH A . D 4 HOH 85 342 342 HOH HOH A . D 4 HOH 86 343 343 HOH HOH A . D 4 HOH 87 345 345 HOH HOH A . D 4 HOH 88 346 346 HOH HOH A . D 4 HOH 89 348 348 HOH HOH A . D 4 HOH 90 349 349 HOH HOH A . D 4 HOH 91 350 350 HOH HOH A . D 4 HOH 92 352 352 HOH HOH A . D 4 HOH 93 353 353 HOH HOH A . D 4 HOH 94 354 354 HOH HOH A . D 4 HOH 95 355 355 HOH HOH A . D 4 HOH 96 356 356 HOH HOH A . D 4 HOH 97 357 357 HOH HOH A . D 4 HOH 98 358 358 HOH HOH A . D 4 HOH 99 360 360 HOH HOH A . D 4 HOH 100 361 361 HOH HOH A . D 4 HOH 101 362 362 HOH HOH A . D 4 HOH 102 363 363 HOH HOH A . D 4 HOH 103 364 364 HOH HOH A . D 4 HOH 104 365 365 HOH HOH A . D 4 HOH 105 366 366 HOH HOH A . D 4 HOH 106 367 367 HOH HOH A . D 4 HOH 107 368 368 HOH HOH A . D 4 HOH 108 369 369 HOH HOH A . D 4 HOH 109 370 370 HOH HOH A . D 4 HOH 110 371 371 HOH HOH A . D 4 HOH 111 372 372 HOH HOH A . D 4 HOH 112 373 373 HOH HOH A . D 4 HOH 113 374 374 HOH HOH A . D 4 HOH 114 375 375 HOH HOH A . D 4 HOH 115 376 376 HOH HOH A . D 4 HOH 116 377 377 HOH HOH A . D 4 HOH 117 378 378 HOH HOH A . D 4 HOH 118 379 379 HOH HOH A . D 4 HOH 119 380 380 HOH HOH A . D 4 HOH 120 381 381 HOH HOH A . D 4 HOH 121 383 383 HOH HOH A . D 4 HOH 122 385 385 HOH HOH A . D 4 HOH 123 387 387 HOH HOH A . D 4 HOH 124 389 389 HOH HOH A . D 4 HOH 125 390 390 HOH HOH A . D 4 HOH 126 391 391 HOH HOH A . D 4 HOH 127 392 392 HOH HOH A . D 4 HOH 128 393 393 HOH HOH A . D 4 HOH 129 394 394 HOH HOH A . D 4 HOH 130 395 395 HOH HOH A . D 4 HOH 131 396 396 HOH HOH A . D 4 HOH 132 397 397 HOH HOH A . D 4 HOH 133 400 400 HOH HOH A . D 4 HOH 134 401 401 HOH HOH A . D 4 HOH 135 403 403 HOH HOH A . D 4 HOH 136 404 404 HOH HOH A . D 4 HOH 137 405 405 HOH HOH A . D 4 HOH 138 407 407 HOH HOH A . D 4 HOH 139 408 408 HOH HOH A . D 4 HOH 140 410 410 HOH HOH A . D 4 HOH 141 411 411 HOH HOH A . D 4 HOH 142 412 412 HOH HOH A . D 4 HOH 143 413 413 HOH HOH A . D 4 HOH 144 414 414 HOH HOH A . D 4 HOH 145 415 415 HOH HOH A . D 4 HOH 146 416 416 HOH HOH A . D 4 HOH 147 417 417 HOH HOH A . D 4 HOH 148 418 418 HOH HOH A . D 4 HOH 149 419 419 HOH HOH A . D 4 HOH 150 420 420 HOH HOH A . D 4 HOH 151 421 421 HOH HOH A . D 4 HOH 152 423 423 HOH HOH A . D 4 HOH 153 424 424 HOH HOH A . D 4 HOH 154 425 425 HOH HOH A . D 4 HOH 155 426 426 HOH HOH A . D 4 HOH 156 427 427 HOH HOH A . D 4 HOH 157 429 429 HOH HOH A . D 4 HOH 158 430 430 HOH HOH A . D 4 HOH 159 431 431 HOH HOH A . D 4 HOH 160 432 432 HOH HOH A . D 4 HOH 161 433 433 HOH HOH A . D 4 HOH 162 434 434 HOH HOH A . D 4 HOH 163 435 435 HOH HOH A . D 4 HOH 164 436 436 HOH HOH A . D 4 HOH 165 437 437 HOH HOH A . D 4 HOH 166 439 439 HOH HOH A . D 4 HOH 167 440 440 HOH HOH A . D 4 HOH 168 441 441 HOH HOH A . D 4 HOH 169 442 442 HOH HOH A . D 4 HOH 170 443 443 HOH HOH A . D 4 HOH 171 444 444 HOH HOH A . D 4 HOH 172 445 445 HOH HOH A . D 4 HOH 173 446 446 HOH HOH A . D 4 HOH 174 447 447 HOH HOH A . D 4 HOH 175 448 448 HOH HOH A . D 4 HOH 176 449 449 HOH HOH A . D 4 HOH 177 450 450 HOH HOH A . D 4 HOH 178 451 451 HOH HOH A . D 4 HOH 179 452 452 HOH HOH A . D 4 HOH 180 453 453 HOH HOH A . D 4 HOH 181 454 454 HOH HOH A . D 4 HOH 182 455 455 HOH HOH A . D 4 HOH 183 456 456 HOH HOH A . D 4 HOH 184 457 457 HOH HOH A . D 4 HOH 185 458 458 HOH HOH A . D 4 HOH 186 459 459 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 73.9 ? 2 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 131.4 ? 3 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 66.5 ? 4 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 69.5 ? 5 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 138.8 ? 6 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 154.7 ? 7 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 72.8 ? 8 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 89.8 ? 9 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 80.0 ? 10 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 96.8 ? 11 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 130.0 ? 12 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 141.2 ? 13 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 76.0 ? 14 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 79.0 ? 15 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 73.6 ? 16 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 138.0 ? 17 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 113.1 ? 18 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 84.7 ? 19 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 83.7 ? 20 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 144.4 ? 21 O ? A ASP 106 ? A ASP 106 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O3 ? B FUC . ? B FUC 4 ? 1_555 71.6 ? 22 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 77.4 ? 23 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 76.9 ? 24 OD1 ? A ASN 83 ? A ASN 83 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 117.6 ? 25 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 77.2 ? 26 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 149.8 ? 27 O ? A ASP 106 ? A ASP 106 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 132.3 ? 28 O3 ? B FUC . ? B FUC 4 ? 1_555 CA ? C CA . ? A CA 160 ? 1_555 O4 ? B FUC . ? B FUC 4 ? 1_555 65.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-10-13 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' Advisory 4 4 'Structure model' 'Atomic model' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' chem_comp 3 4 'Structure model' entity 4 4 'Structure model' pdbx_branch_scheme 5 4 'Structure model' pdbx_chem_comp_identifier 6 4 'Structure model' pdbx_entity_branch 7 4 'Structure model' pdbx_entity_branch_descriptor 8 4 'Structure model' pdbx_entity_branch_link 9 4 'Structure model' pdbx_entity_branch_list 10 4 'Structure model' pdbx_entity_nonpoly 11 4 'Structure model' pdbx_nonpoly_scheme 12 4 'Structure model' pdbx_struct_assembly_gen 13 4 'Structure model' pdbx_struct_conn_angle 14 4 'Structure model' pdbx_unobs_or_zero_occ_residues 15 4 'Structure model' struct_asym 16 4 'Structure model' struct_conn 17 4 'Structure model' struct_site 18 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_atom_site.auth_asym_id' 6 4 'Structure model' '_atom_site.auth_atom_id' 7 4 'Structure model' '_atom_site.auth_comp_id' 8 4 'Structure model' '_atom_site.auth_seq_id' 9 4 'Structure model' '_atom_site.label_asym_id' 10 4 'Structure model' '_atom_site.label_atom_id' 11 4 'Structure model' '_atom_site.label_comp_id' 12 4 'Structure model' '_atom_site.label_entity_id' 13 4 'Structure model' '_atom_site.type_symbol' 14 4 'Structure model' '_chem_comp.mon_nstd_flag' 15 4 'Structure model' '_chem_comp.name' 16 4 'Structure model' '_chem_comp.type' 17 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id' 27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 33 4 'Structure model' '_pdbx_struct_conn_angle.value' 34 4 'Structure model' '_struct_conn.pdbx_dist_value' 35 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 36 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 37 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 38 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 39 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 40 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 41 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 42 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 43 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 44 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 45 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 46 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 47 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 48 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 49 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 CNS refinement . ? 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 23 ? ? -122.89 -140.24 2 1 HIS A 25 ? ? -173.55 -178.23 3 1 TYR A 48 ? ? 63.85 -169.86 4 1 ASN A 75 ? ? -149.16 48.66 5 1 SER A 128 ? ? 59.48 9.22 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 MAG 1 B MAG 1 C 1NA 603 n B 2 GAL 2 B GAL 2 C GAL 602 n B 2 SIA 3 B SIA 3 C SIA 601 n B 2 FUC 4 B FUC 4 C FUC 604 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 LFucpa FUC 'COMMON NAME' GMML 1.0 a-L-fucopyranose FUC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-L-Fucp FUC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Fuc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal MAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DGlcpNAc[1Me]b' MAG 'COMMON NAME' GMML 1.0 1-methyl-N-acetyl-b-D-glucopyranose MAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-methyl-N-acetyl-D-glucosamine SIA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DNeup5Aca SIA 'COMMON NAME' GMML 1.0 'N-acetyl-a-D-neuraminic acid' SIA 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Neup5Ac SIA 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Neu5Ac # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DNeup5Aca2-3DGalpb1-4[LFucpa1-3]DGlcpNAc[1Me]b1-OME' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/4,4,3/[a2122h-1b_1-5_1*OC_2*NCC/3=O][a1221m-1a_1-5][a2112h-1b_1-5][Aad21122h-2a_2-6_5*NCC/3=O]/1-2-3-4/a3-b1_a4-c1_c3-d2' WURCS PDB2Glycan 1.1.0 3 2 '[][methyl]{[(1+1)][b-D-GlcpNAc]{[(3+1)][a-L-Fucp]{}[(4+1)][b-D-Galp]{[(3+2)][a-D-Neup5Ac]{}}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 GAL C1 O1 1 MAG O4 HO4 sing ? 2 2 3 SIA C2 O2 2 GAL O3 HO3 sing ? 3 2 4 FUC C1 O1 1 MAG O3 HO3 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 MAG 1 n 2 GAL 2 n 2 SIA 3 n 2 FUC 4 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CALCIUM ION' CA 4 water HOH #