data_1G1Z
# 
_entry.id   1G1Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1G1Z         pdb_00001g1z 10.2210/pdb1g1z/pdb 
RCSB  RCSB012133   ?            ?                   
WWPDB D_1000012133 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1G1P 
_pdbx_database_related.details        '1G1P represents the conotoxin EVIA with the Leu12-Pro13 trans peptide bond.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1G1Z 
_pdbx_database_status.recvd_initial_deposition_date   2000-10-16 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Volpon, L.'     1 
'Lamthanh, H.'   2 
'Le Gall, F.'    3 
'Menez, A.'      4 
'Lancelin, J.M.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'NMR Solution Structures of delta-Conotoxin EVIA from Conus ermineus That Selectively Acts on Vertebrate Neuronal Na+ Channels.'   
J.Biol.Chem.      279 21356 21366 2004 JBCHA3 US 0021-9258 0071 ? 14976206 10.1074/jbc.M309594200 
1       
'Conotoxin EVIA, a Novel Peptide from Conus ermineus Venom that Preferentially Acts on Neuronal Voltage-dependent Sodium Channels' 
'To be Published' ?   ?     ?     ?    ?      ?  ?         0353 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Volpon, L.'      1  ? 
primary 'Lamthanh, H.'    2  ? 
primary 'Barbier, J.'     3  ? 
primary 'Gilles, N.'      4  ? 
primary 'Lancelin, J.M.'  5  ? 
1       'Barbier, J.'     6  ? 
1       'Lamthanh, H.'    7  ? 
1       'Le Gall, F.'     8  ? 
1       'Favreau, P.'     9  ? 
1       'Benoit, E.'      10 ? 
1       'Chen, H.'        11 ? 
1       'Gilles, N.'      12 ? 
1       'Ilan, N.'        13 ? 
1       'Heinemann, S.F.' 14 ? 
1       'Gordon, D.'      15 ? 
1       'Menez, A.'       16 ? 
1       'Molgo, J.'       17 ? 
# 
_cell.entry_id           1G1Z 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1G1Z 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 syn 
_entity.pdbx_description           'CONOTOXIN EVIA' 
_entity.formula_weight             3294.909 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    'THIS STRUCTURE IS IN EQUILIBRIUM WITH THE LEU12-PRO13 TRANS ISOMER (1G1P).' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'DDCIK(HYP)YGFCSLPILKNGLCCSGACVGVCADL(NH2)' 
_entity_poly.pdbx_seq_one_letter_code_can   DDCIKPYGFCSLPILKNGLCCSGACVGVCADLX 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASP n 
1 2  ASP n 
1 3  CYS n 
1 4  ILE n 
1 5  LYS n 
1 6  HYP n 
1 7  TYR n 
1 8  GLY n 
1 9  PHE n 
1 10 CYS n 
1 11 SER n 
1 12 LEU n 
1 13 PRO n 
1 14 ILE n 
1 15 LEU n 
1 16 LYS n 
1 17 ASN n 
1 18 GLY n 
1 19 LEU n 
1 20 CYS n 
1 21 CYS n 
1 22 SER n 
1 23 GLY n 
1 24 ALA n 
1 25 CYS n 
1 26 VAL n 
1 27 GLY n 
1 28 VAL n 
1 29 CYS n 
1 30 ALA n 
1 31 ASP n 
1 32 LEU n 
1 33 NH2 n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;The solid phase synthesis of conotoxin EVIA was carried out using the F-moc chemistry. The sequence of the peptide is naturally found in Conus ermineus (Atlantic fish-hunting cone).
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CXD6A_CONER 
_struct_ref.pdbx_db_accession          P60513 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1G1Z 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 32 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P60513 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  32 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?              'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE       ?              'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?              'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?              'C3 H7 N O2 S'   121.158 
GLY 'peptide linking'   y GLYCINE          ?              'C2 H5 N O2'     75.067  
HYP 'L-peptide linking' n 4-HYDROXYPROLINE HYDROXYPROLINE 'C5 H9 N O3'     131.130 
ILE 'L-peptide linking' y ISOLEUCINE       ?              'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?              'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?              'C6 H15 N2 O2 1' 147.195 
NH2 non-polymer         . 'AMINO GROUP'    ?              'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE    ?              'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?              'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?              'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE         ?              'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?              'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 NOESY    
2 1 1 DQF-COSY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         283 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  3.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.01 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '2 mM conotoxin EVIA; 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_pdbx_nmr_refine.entry_id           1G1Z 
_pdbx_nmr_refine.method             
;hybrid distance geometry dynamical simulated annealing with the allhdg force field and simulated annealing with the CHARMM22 force field
;
_pdbx_nmr_refine.details            
;the structures are based on a total of 257 restraints, 211 are NOE-derived distance constraints, 24 dihedral angle restraints, 22 distance restraints from hydrogen bonds.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1G1Z 
_pdbx_nmr_details.text       'This structure was determined using standard 2D homonuclear techniques' 
# 
_pdbx_nmr_ensemble.entry_id                                      1G1Z 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             18 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations,structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1G1Z 
_pdbx_nmr_representative.conformer_id         14 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6   collection      Bruker  1 
Gifa    4.22  'data analysis' Delsuc  2 
X-PLOR  3.851 refinement      Brunger 3 
CHARMM  22    refinement      Brooks  4 
# 
_exptl.entry_id          1G1Z 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1G1Z 
_struct.title                     
;NMR Solution Structures of delta-Conotoxin EVIA from Conus ermineus that Selectively Acts on Vertebrate Neuronal Na+ Channels, LEU12-PRO13 Cis isomer
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1G1Z 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'three disulfide linkages, cis/trans isomerism of Leu12-Pro13 peptide bond, hydroxyproline, TOXIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 3  SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 3  A CYS 21 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf2 disulf ?    ? A CYS 10 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 10 A CYS 25 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf3 disulf ?    ? A CYS 20 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 20 A CYS 29 1_555 ? ? ? ? ? ? ? 2.014 ? ? 
covale1 covale both ? A LYS 5  C  ? ? ? 1_555 A HYP 6  N  ? ? A LYS 5  A HYP 6  1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale2 covale both ? A HYP 6  C  ? ? ? 1_555 A TYR 7  N  ? ? A HYP 6  A TYR 7  1_555 ? ? ? ? ? ? ? 1.357 ? ? 
covale3 covale both ? A LEU 32 C  ? ? ? 1_555 A NH2 33 N  ? ? A LEU 32 A NH2 33 1_555 ? ? ? ? ? ? ? 1.358 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 1  -6.31  
2  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 2  -1.15  
3  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 3  14.56  
4  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 4  -23.72 
5  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 5  -2.57  
6  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 6  -16.82 
7  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 7  -9.27  
8  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 8  17.58  
9  LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 9  5.63   
10 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 10 -8.57  
11 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 11 -1.54  
12 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 12 0.99   
13 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 13 -23.29 
14 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 14 -19.19 
15 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 15 -5.08  
16 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 16 -1.20  
17 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 17 -10.90 
18 LEU 12 A . ? LEU 12 A PRO 13 A ? PRO 13 A 18 -10.48 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 24 ? CYS A 25 ? ALA A 24 CYS A 25 
A 2 CYS A 29 ? ALA A 30 ? CYS A 29 ALA A 30 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     24 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    30 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     30 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    NH2 
_struct_site.pdbx_auth_seq_id     33 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE NH2 A 33' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        LEU 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         32 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         LEU 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          32 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1G1Z 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1G1Z 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASP 1  1  1  ASP ASP A . n 
A 1 2  ASP 2  2  2  ASP ASP A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  ILE 4  4  4  ILE ILE A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  HYP 6  6  6  HYP HYP A . n 
A 1 7  TYR 7  7  7  TYR TYR A . n 
A 1 8  GLY 8  8  8  GLY GLY A . n 
A 1 9  PHE 9  9  9  PHE PHE A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 SER 11 11 11 SER SER A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 PRO 13 13 13 PRO PRO A . n 
A 1 14 ILE 14 14 14 ILE ILE A . n 
A 1 15 LEU 15 15 15 LEU LEU A . n 
A 1 16 LYS 16 16 16 LYS LYS A . n 
A 1 17 ASN 17 17 17 ASN ASN A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 LEU 19 19 19 LEU LEU A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 CYS 21 21 21 CYS CYS A . n 
A 1 22 SER 22 22 22 SER SER A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 ALA 24 24 24 ALA ALA A . n 
A 1 25 CYS 25 25 25 CYS CYS A . n 
A 1 26 VAL 26 26 26 VAL VAL A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 VAL 28 28 28 VAL VAL A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 ASP 31 31 31 ASP ASP A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 NH2 33 33 33 NH2 NH2 A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    HYP 
_pdbx_struct_mod_residue.label_seq_id     6 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     HYP 
_pdbx_struct_mod_residue.auth_seq_id      6 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   PRO 
_pdbx_struct_mod_residue.details          4-HYDROXYPROLINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-11-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_nmr_software     
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 4 'Structure model' struct_conn           
6 4 'Structure model' struct_site           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
5 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 3  HG A SER 22 ? ? O   A ALA 30 ? ? 1.58 
2 3  HG A SER 11 ? ? OD1 A ASN 17 ? ? 1.58 
3 7  HG A SER 22 ? ? O   A ALA 30 ? ? 1.59 
4 8  HG A SER 11 ? ? OD1 A ASN 17 ? ? 1.58 
5 9  HG A SER 22 ? ? O   A ALA 30 ? ? 1.60 
6 14 HG A SER 22 ? ? O   A ALA 30 ? ? 1.59 
7 15 HG A SER 22 ? ? O   A ALA 30 ? ? 1.60 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  2  N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 93.89 111.00 -17.11 2.70 N 
2  3  N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.34 111.00 -16.66 2.70 N 
3  4  N A SER 11 ? ? CA A SER 11 ? ? C A SER 11 ? ? 94.65 111.00 -16.35 2.70 N 
4  5  N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.31 113.10 -15.79 2.50 N 
5  8  N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.36 111.00 -16.64 2.70 N 
6  9  N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.55 111.00 -16.45 2.70 N 
7  10 N A LEU 12 ? ? CA A LEU 12 ? ? C A LEU 12 ? ? 94.37 111.00 -16.63 2.70 N 
8  10 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.22 113.10 -15.88 2.50 N 
9  13 N A ILE 14 ? ? CA A ILE 14 ? ? C A ILE 14 ? ? 94.71 111.00 -16.29 2.70 N 
10 13 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.42 113.10 -15.68 2.50 N 
11 13 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.57 111.00 -16.43 2.70 N 
12 14 N A LEU 12 ? ? CA A LEU 12 ? ? C A LEU 12 ? ? 94.50 111.00 -16.50 2.70 N 
13 14 N A GLY 18 ? ? CA A GLY 18 ? ? C A GLY 18 ? ? 97.11 113.10 -15.99 2.50 N 
14 14 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.43 111.00 -16.57 2.70 N 
15 15 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 94.68 111.00 -16.32 2.70 N 
16 17 N A LYS 16 ? ? CA A LYS 16 ? ? C A LYS 16 ? ? 93.22 111.00 -17.78 2.70 N 
17 18 N A VAL 26 ? ? CA A VAL 26 ? ? C A VAL 26 ? ? 92.97 111.00 -18.03 2.70 N 
18 18 N A LEU 32 ? ? CA A LEU 32 ? ? C A LEU 32 ? ? 93.19 111.00 -17.81 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASP A 2  ? ? -172.67 -170.68 
2  1  CYS A 10 ? ? -111.21 -123.31 
3  1  LEU A 15 ? ? -137.45 -63.13  
4  1  ASN A 17 ? ? -162.05 -166.66 
5  1  VAL A 26 ? ? -160.32 60.49   
6  1  ALA A 30 ? ? -150.37 -153.86 
7  2  CYS A 3  ? ? -176.46 -177.88 
8  2  VAL A 26 ? ? -145.03 54.79   
9  2  ALA A 30 ? ? -129.84 -153.26 
10 3  ASP A 2  ? ? -97.29  -71.99  
11 3  ASN A 17 ? ? -89.57  -109.63 
12 3  VAL A 26 ? ? -144.99 48.10   
13 3  ALA A 30 ? ? -143.94 -143.70 
14 4  ILE A 14 ? ? -150.03 -46.04  
15 4  LEU A 15 ? ? -117.33 -151.73 
16 4  LYS A 16 ? ? -91.81  59.96   
17 4  ASN A 17 ? ? -83.84  -122.71 
18 4  VAL A 26 ? ? -150.59 49.07   
19 4  ALA A 30 ? ? -129.32 -162.36 
20 5  PRO A 13 ? ? -69.72  -77.24  
21 5  LEU A 15 ? ? -140.44 -98.19  
22 5  ASN A 17 ? ? 177.19  -173.35 
23 5  ALA A 30 ? ? -142.16 -145.25 
24 6  SER A 11 ? ? -164.09 -125.24 
25 6  LEU A 15 ? ? 79.08   -35.47  
26 6  ASN A 17 ? ? -133.85 -129.63 
27 6  VAL A 26 ? ? -151.36 56.57   
28 6  ALA A 30 ? ? -145.12 -153.37 
29 7  CYS A 10 ? ? -109.60 -115.00 
30 7  SER A 11 ? ? -167.15 -163.30 
31 7  LEU A 15 ? ? -124.72 -79.08  
32 7  ASN A 17 ? ? -160.36 -50.06  
33 7  VAL A 26 ? ? -160.03 58.65   
34 7  ALA A 30 ? ? -140.65 -150.09 
35 8  ASP A 2  ? ? -88.79  -77.75  
36 8  LEU A 15 ? ? 75.19   -48.58  
37 8  ASN A 17 ? ? -80.50  -70.07  
38 8  VAL A 26 ? ? -115.71 -130.39 
39 8  ALA A 30 ? ? -133.44 -154.75 
40 8  ASP A 31 ? ? -124.88 -163.59 
41 9  LEU A 15 ? ? -137.00 -77.09  
42 9  ASN A 17 ? ? 176.91  175.41  
43 9  VAL A 26 ? ? -144.53 44.39   
44 9  ALA A 30 ? ? -152.58 -151.87 
45 10 ASP A 2  ? ? 69.66   -103.69 
46 10 LEU A 15 ? ? -108.92 -64.00  
47 10 LYS A 16 ? ? -152.24 42.01   
48 10 ASN A 17 ? ? -90.49  -144.37 
49 10 VAL A 26 ? ? -130.04 -132.37 
50 11 ILE A 14 ? ? 42.08   -112.87 
51 11 LEU A 15 ? ? -134.66 -146.71 
52 11 VAL A 26 ? ? -115.79 -132.59 
53 11 ALA A 30 ? ? -129.68 -149.92 
54 12 CYS A 10 ? ? -134.36 -157.81 
55 12 SER A 11 ? ? -173.23 -177.13 
56 12 LEU A 15 ? ? -167.12 -96.80  
57 12 VAL A 26 ? ? -142.41 37.59   
58 12 ALA A 30 ? ? -134.62 -159.51 
59 13 SER A 11 ? ? -173.68 -169.31 
60 13 VAL A 26 ? ? -149.54 46.80   
61 13 ALA A 30 ? ? -145.43 -141.97 
62 14 ASP A 2  ? ? 75.72   -67.58  
63 14 VAL A 26 ? ? -122.62 -137.24 
64 14 ALA A 30 ? ? -130.74 -146.09 
65 15 ASP A 2  ? ? -93.38  -153.42 
66 15 CYS A 10 ? ? -109.09 -90.91  
67 15 SER A 11 ? ? -170.56 -176.02 
68 15 LEU A 15 ? ? 111.78  -110.85 
69 15 ASN A 17 ? ? -174.73 -60.61  
70 15 VAL A 26 ? ? -140.73 42.85   
71 15 ALA A 30 ? ? -141.81 -146.58 
72 16 ASP A 2  ? ? -125.78 -76.55  
73 16 ASN A 17 ? ? 178.95  -172.43 
74 16 VAL A 26 ? ? -141.99 45.61   
75 16 ALA A 30 ? ? -135.68 -158.58 
76 17 CYS A 3  ? ? 175.26  -175.01 
77 17 LEU A 15 ? ? -171.41 -64.40  
78 17 LYS A 16 ? ? -117.46 -101.32 
79 17 ALA A 30 ? ? -148.82 -147.40 
80 18 ASP A 2  ? ? -166.55 -165.26 
81 18 ILE A 14 ? ? 80.63   -91.09  
82 18 ASN A 17 ? ? -77.41  -87.61  
83 18 LEU A 19 ? ? -91.57  -155.15 
84 18 VAL A 26 ? ? -159.30 -142.02 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    15 
_pdbx_validate_peptide_omega.auth_comp_id_1   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    1 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    2 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            147.83 
#