data_1G4G # _entry.id 1G4G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G4G pdb_00001g4g 10.2210/pdb1g4g/pdb RCSB RCSB012220 ? ? WWPDB D_1000012220 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1G4F _pdbx_database_related.details 'ENSEMBLE OF 20 STRUCTURES' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G4G _pdbx_database_status.recvd_initial_deposition_date 2000-10-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hoshino, M.' 1 'Hagihara, Y.' 2 'Nishii, I.' 3 'Yamazaki, T.' 4 'Kato, H.' 5 'Goto, Y.' 6 # _citation.id primary _citation.title 'Identification of the phospholipid-binding site of human beta(2)-glycoprotein I domain V by heteronuclear magnetic resonance.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 304 _citation.page_first 927 _citation.page_last 939 _citation.year 2000 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11124037 _citation.pdbx_database_id_DOI 10.1006/jmbi.2000.4243 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoshino, M.' 1 ? primary 'Hagihara, Y.' 2 ? primary 'Nishii, I.' 3 ? primary 'Yamazaki, T.' 4 ? primary 'Kato, H.' 5 ? primary 'Goto, Y.' 6 ? # _cell.entry_id 1G4G _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G4G _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BETA2-GLYCOPROTEIN I' _entity.formula_weight 9755.360 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDA SDVKPC ; _entity_poly.pdbx_seq_one_letter_code_can ;TKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDA SDVKPC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 LYS n 1 3 ALA n 1 4 SER n 1 5 CYS n 1 6 LYS n 1 7 LEU n 1 8 PRO n 1 9 VAL n 1 10 LYS n 1 11 LYS n 1 12 ALA n 1 13 THR n 1 14 VAL n 1 15 VAL n 1 16 TYR n 1 17 GLN n 1 18 GLY n 1 19 GLU n 1 20 ARG n 1 21 VAL n 1 22 LYS n 1 23 ILE n 1 24 GLN n 1 25 GLU n 1 26 LYS n 1 27 PHE n 1 28 LYS n 1 29 ASN n 1 30 GLY n 1 31 MET n 1 32 LEU n 1 33 HIS n 1 34 GLY n 1 35 ASP n 1 36 LYS n 1 37 VAL n 1 38 SER n 1 39 PHE n 1 40 PHE n 1 41 CYS n 1 42 LYS n 1 43 ASN n 1 44 LYS n 1 45 GLU n 1 46 LYS n 1 47 LYS n 1 48 CYS n 1 49 SER n 1 50 TYR n 1 51 THR n 1 52 GLU n 1 53 ASP n 1 54 ALA n 1 55 GLN n 1 56 CYS n 1 57 ILE n 1 58 ASP n 1 59 GLY n 1 60 THR n 1 61 ILE n 1 62 GLU n 1 63 VAL n 1 64 PRO n 1 65 LYS n 1 66 CYS n 1 67 PHE n 1 68 LYS n 1 69 GLU n 1 70 HIS n 1 71 SER n 1 72 SER n 1 73 LEU n 1 74 ALA n 1 75 PHE n 1 76 TRP n 1 77 LYS n 1 78 THR n 1 79 ASP n 1 80 ALA n 1 81 SER n 1 82 ASP n 1 83 VAL n 1 84 LYS n 1 85 PRO n 1 86 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Pichia pastoris' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4922 _entity_src_gen.host_org_genus Pichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOH_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDA SDVKPC ; _struct_ref.pdbx_align_begin 260 _struct_ref.pdbx_db_accession P02749 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G4G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 86 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02749 _struct_ref_seq.db_align_beg 260 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1G4G THR A 1 ? UNP P02749 CYS 260 conflict 1 1 1 1G4G LEU A 7 ? UNP P02749 VAL 266 variant 7 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 3 1 1 HNCO-TROSY 4 1 1 HMQC-J 5 1 1 HNHB 6 1 1 'HN(CO)HB' 7 1 1 N15-TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM beta2-glycoprotein I domain V U-15N; 20mM Na-phosphate buffer, pH 6.0; 90% H2O, 10% D2O' '90% H2O/10% D2O' 2 '1mM beta2-glycoprotein I domain V U-15N,13C; 20mM Na-phosphate buffer, pD 6.0; 100% D2O' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DMX 800 # _pdbx_nmr_refine.entry_id 1G4G _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;the structures are based on a total of 1402 restraints, 1288 are NOE-derived distance constraints, 88 dihedral angle restraints, 26 distance restraints from hydrogen bonds ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1G4G _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1G4G _pdbx_nmr_representative.conformer_id ? _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.841 'structure solution' Brunger 1 X-PLOR 3.841 refinement Brunger 2 # _exptl.entry_id 1G4G _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1G4G _struct.title 'NMR STRUCTURE OF THE FIFTH DOMAIN OF HUMAN BETA2-GLYCOPROTEIN I' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1G4G _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'short consensus repeat, sushi-domain, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 23 ? PHE A 27 ? ILE A 23 PHE A 27 1 ? 5 HELX_P HELX_P2 2 ASP A 79 ? VAL A 83 ? ASP A 79 VAL A 83 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 5 A CYS 56 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 41 A CYS 66 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 48 A CYS 86 1_555 ? ? ? ? ? ? ? 2.022 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 13 ? VAL A 15 ? THR A 13 VAL A 15 A 2 ARG A 20 ? LYS A 22 ? ARG A 20 LYS A 22 B 1 LYS A 36 ? ASN A 43 ? LYS A 36 ASN A 43 B 2 CYS A 48 ? ILE A 57 ? CYS A 48 ILE A 57 B 3 THR A 60 ? ILE A 61 ? THR A 60 ILE A 61 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 14 ? O VAL A 14 N VAL A 21 ? N VAL A 21 B 1 2 N ASN A 43 ? N ASN A 43 O CYS A 48 ? O CYS A 48 B 2 3 N ILE A 57 ? N ILE A 57 O THR A 60 ? O THR A 60 # _database_PDB_matrix.entry_id 1G4G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1G4G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR THR A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 CYS 86 86 86 CYS CYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-11-15 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ASP 79 ? ? H A ASP 82 ? ? 1.49 2 1 H A ASN 43 ? ? O A CYS 48 ? ? 1.52 3 1 H A CYS 5 ? ? O A MET 31 ? ? 1.54 4 1 H A ALA 3 ? ? OD1 A ASP 58 ? ? 1.56 5 1 O A LYS 22 ? ? H A GLU 25 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 4 ? ? -54.67 -178.47 2 1 CYS A 5 ? ? -101.78 -145.10 3 1 LEU A 7 ? ? -39.65 100.65 4 1 LYS A 11 ? ? -148.21 43.13 5 1 ASN A 29 ? ? -100.24 51.79 6 1 ASP A 58 ? ? -53.60 97.33 7 1 PHE A 67 ? ? -55.10 172.65 8 1 HIS A 70 ? ? -160.12 -35.87 9 1 SER A 71 ? ? 46.44 95.53 10 1 SER A 72 ? ? -55.34 -164.08 11 1 LEU A 73 ? ? 57.40 71.13 12 1 PHE A 75 ? ? -106.34 -159.58 13 1 TRP A 76 ? ? -60.20 94.18 14 1 LYS A 77 ? ? -178.87 108.41 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 20 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.153 _pdbx_validate_planes.type 'SIDE CHAIN' #