data_1G5V # _entry.id 1G5V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1G5V pdb_00001g5v 10.2210/pdb1g5v/pdb RCSB RCSB012271 ? ? WWPDB D_1000012271 ? ? BMRB 4899 ? 10.13018/BMR4899 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-02 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1G5V _pdbx_database_status.recvd_initial_deposition_date 2000-11-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 4899 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Selenko, P.' 1 'Sprangers, R.' 2 'Stier, G.' 3 'Buehler, D.' 4 'Fischer, U.' 5 'Sattler, M.' 6 # _citation.id primary _citation.title 'SMN tudor domain structure and its interaction with the Sm proteins.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 8 _citation.page_first 27 _citation.page_last 31 _citation.year 2001 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11135666 _citation.pdbx_database_id_DOI 10.1038/83014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Selenko, P.' 1 ? primary 'Sprangers, R.' 2 ? primary 'Stier, G.' 3 ? primary 'Buhler, D.' 4 ? primary 'Fischer, U.' 5 ? primary 'Sattler, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'SURVIVAL MOTOR NEURON PROTEIN 1' _entity.formula_weight 9796.644 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'TUDOR DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENEN ESQVSTDE ; _entity_poly.pdbx_seq_one_letter_code_can ;KKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENEN ESQVSTDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LYS n 1 3 ASN n 1 4 THR n 1 5 ALA n 1 6 ALA n 1 7 SER n 1 8 LEU n 1 9 GLN n 1 10 GLN n 1 11 TRP n 1 12 LYS n 1 13 VAL n 1 14 GLY n 1 15 ASP n 1 16 LYS n 1 17 CYS n 1 18 SER n 1 19 ALA n 1 20 ILE n 1 21 TRP n 1 22 SER n 1 23 GLU n 1 24 ASP n 1 25 GLY n 1 26 CYS n 1 27 ILE n 1 28 TYR n 1 29 PRO n 1 30 ALA n 1 31 THR n 1 32 ILE n 1 33 ALA n 1 34 SER n 1 35 ILE n 1 36 ASP n 1 37 PHE n 1 38 LYS n 1 39 ARG n 1 40 GLU n 1 41 THR n 1 42 CYS n 1 43 VAL n 1 44 VAL n 1 45 VAL n 1 46 TYR n 1 47 THR n 1 48 GLY n 1 49 TYR n 1 50 GLY n 1 51 ASN n 1 52 ARG n 1 53 GLU n 1 54 GLU n 1 55 GLN n 1 56 ASN n 1 57 LEU n 1 58 SER n 1 59 ASP n 1 60 LEU n 1 61 LEU n 1 62 SER n 1 63 PRO n 1 64 ILE n 1 65 CYS n 1 66 GLU n 1 67 VAL n 1 68 ALA n 1 69 ASN n 1 70 ASN n 1 71 ILE n 1 72 GLU n 1 73 GLN n 1 74 ASN n 1 75 ALA n 1 76 GLN n 1 77 GLU n 1 78 ASN n 1 79 GLU n 1 80 ASN n 1 81 GLU n 1 82 SER n 1 83 GLN n 1 84 VAL n 1 85 SER n 1 86 THR n 1 87 ASP n 1 88 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene SMN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene 'EXPRESSED AS FUSION PROTEIN WITH N-TERMINAL HIS6-GST AND TEV CLEAVAGE SITE' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET9D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 82 ? ? ? A . n A 1 2 LYS 2 83 ? ? ? A . n A 1 3 ASN 3 84 ? ? ? A . n A 1 4 THR 4 85 ? ? ? A . n A 1 5 ALA 5 86 ? ? ? A . n A 1 6 ALA 6 87 ? ? ? A . n A 1 7 SER 7 88 ? ? ? A . n A 1 8 LEU 8 89 ? ? ? A . n A 1 9 GLN 9 90 90 GLN GLN A . n A 1 10 GLN 10 91 91 GLN GLN A . n A 1 11 TRP 11 92 92 TRP TRP A . n A 1 12 LYS 12 93 93 LYS LYS A . n A 1 13 VAL 13 94 94 VAL VAL A . n A 1 14 GLY 14 95 95 GLY GLY A . n A 1 15 ASP 15 96 96 ASP ASP A . n A 1 16 LYS 16 97 97 LYS LYS A . n A 1 17 CYS 17 98 98 CYS CYS A . n A 1 18 SER 18 99 99 SER SER A . n A 1 19 ALA 19 100 100 ALA ALA A . n A 1 20 ILE 20 101 101 ILE ILE A . n A 1 21 TRP 21 102 102 TRP TRP A . n A 1 22 SER 22 103 103 SER SER A . n A 1 23 GLU 23 104 104 GLU GLU A . n A 1 24 ASP 24 105 105 ASP ASP A . n A 1 25 GLY 25 106 106 GLY GLY A . n A 1 26 CYS 26 107 107 CYS CYS A . n A 1 27 ILE 27 108 108 ILE ILE A . n A 1 28 TYR 28 109 109 TYR TYR A . n A 1 29 PRO 29 110 110 PRO PRO A . n A 1 30 ALA 30 111 111 ALA ALA A . n A 1 31 THR 31 112 112 THR THR A . n A 1 32 ILE 32 113 113 ILE ILE A . n A 1 33 ALA 33 114 114 ALA ALA A . n A 1 34 SER 34 115 115 SER SER A . n A 1 35 ILE 35 116 116 ILE ILE A . n A 1 36 ASP 36 117 117 ASP ASP A . n A 1 37 PHE 37 118 118 PHE PHE A . n A 1 38 LYS 38 119 119 LYS LYS A . n A 1 39 ARG 39 120 120 ARG ARG A . n A 1 40 GLU 40 121 121 GLU GLU A . n A 1 41 THR 41 122 122 THR THR A . n A 1 42 CYS 42 123 123 CYS CYS A . n A 1 43 VAL 43 124 124 VAL VAL A . n A 1 44 VAL 44 125 125 VAL VAL A . n A 1 45 VAL 45 126 126 VAL VAL A . n A 1 46 TYR 46 127 127 TYR TYR A . n A 1 47 THR 47 128 128 THR THR A . n A 1 48 GLY 48 129 129 GLY GLY A . n A 1 49 TYR 49 130 130 TYR TYR A . n A 1 50 GLY 50 131 131 GLY GLY A . n A 1 51 ASN 51 132 132 ASN ASN A . n A 1 52 ARG 52 133 133 ARG ARG A . n A 1 53 GLU 53 134 134 GLU GLU A . n A 1 54 GLU 54 135 135 GLU GLU A . n A 1 55 GLN 55 136 136 GLN GLN A . n A 1 56 ASN 56 137 137 ASN ASN A . n A 1 57 LEU 57 138 138 LEU LEU A . n A 1 58 SER 58 139 139 SER SER A . n A 1 59 ASP 59 140 140 ASP ASP A . n A 1 60 LEU 60 141 141 LEU LEU A . n A 1 61 LEU 61 142 142 LEU LEU A . n A 1 62 SER 62 143 143 SER SER A . n A 1 63 PRO 63 144 144 PRO PRO A . n A 1 64 ILE 64 145 145 ILE ILE A . n A 1 65 CYS 65 146 ? ? ? A . n A 1 66 GLU 66 147 ? ? ? A . n A 1 67 VAL 67 148 ? ? ? A . n A 1 68 ALA 68 149 ? ? ? A . n A 1 69 ASN 69 150 ? ? ? A . n A 1 70 ASN 70 151 ? ? ? A . n A 1 71 ILE 71 152 ? ? ? A . n A 1 72 GLU 72 153 ? ? ? A . n A 1 73 GLN 73 154 ? ? ? A . n A 1 74 ASN 74 155 ? ? ? A . n A 1 75 ALA 75 156 ? ? ? A . n A 1 76 GLN 76 157 ? ? ? A . n A 1 77 GLU 77 158 ? ? ? A . n A 1 78 ASN 78 159 ? ? ? A . n A 1 79 GLU 79 160 ? ? ? A . n A 1 80 ASN 80 161 ? ? ? A . n A 1 81 GLU 81 162 ? ? ? A . n A 1 82 SER 82 163 ? ? ? A . n A 1 83 GLN 83 164 ? ? ? A . n A 1 84 VAL 84 165 ? ? ? A . n A 1 85 SER 85 166 ? ? ? A . n A 1 86 THR 86 167 ? ? ? A . n A 1 87 ASP 87 168 ? ? ? A . n A 1 88 GLU 88 169 ? ? ? A . n # _cell.entry_id 1G5V _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1G5V _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1G5V _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1G5V _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1G5V _struct.title 'SOLUTION STRUCTURE OF THE TUDOR DOMAIN OF THE HUMAN SMN PROTEIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1G5V _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'mRNA processing, TRANSLATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SMN_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENEN ESQVSTDE ; _struct_ref.pdbx_align_begin 82 _struct_ref.pdbx_db_accession Q16637 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1G5V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16637 _struct_ref_seq.db_align_beg 82 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 82 _struct_ref_seq.pdbx_auth_seq_align_end 169 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 57 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ASP _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 138 _struct_conf.end_auth_comp_id ASP _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 140 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details B1 ? 1 ? B2 ? 1 ? B3 ? 1 ? B4 ? 1 ? B5 ? 1 ? # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id B1 1 GLY A 14 ? ILE A 20 ? GLY A 95 ILE A 101 B2 1 ILE A 27 ? PHE A 37 ? ILE A 108 PHE A 118 B3 1 THR A 41 ? TYR A 46 ? THR A 122 TYR A 127 B4 1 ASN A 51 ? ASP A 59 ? ASN A 132 ASP A 140 B5 1 LEU A 61 ? SER A 62 ? LEU A 142 SER A 143 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 91 ? ? 59.28 97.53 2 1 THR A 128 ? ? -57.48 106.23 3 1 PRO A 144 ? ? -64.57 -179.61 4 2 GLN A 91 ? ? -75.60 -130.60 5 2 CYS A 98 ? ? -125.75 -164.74 6 2 PHE A 118 ? ? -57.49 -9.02 7 2 LYS A 119 ? ? -51.74 -72.52 8 2 PRO A 144 ? ? -66.99 93.37 9 3 LYS A 119 ? ? -68.80 -72.15 10 3 THR A 128 ? ? -61.98 98.42 11 3 PRO A 144 ? ? -56.72 -79.10 12 4 CYS A 98 ? ? -129.09 -162.54 13 5 GLN A 91 ? ? 65.08 123.94 14 5 CYS A 98 ? ? -136.43 -155.91 15 5 ASP A 105 ? ? -117.23 -76.97 16 5 LYS A 119 ? ? -99.93 -60.62 17 5 GLU A 121 ? ? 38.87 56.31 18 5 TYR A 130 ? ? -115.28 -95.08 19 6 CYS A 98 ? ? -136.26 -154.79 20 6 SER A 103 ? ? -97.36 36.54 21 6 LYS A 119 ? ? -51.97 -75.40 22 7 CYS A 98 ? ? -126.09 -165.13 23 7 ASP A 105 ? ? -144.88 -1.88 24 7 ILE A 113 ? ? -58.55 104.97 25 7 LYS A 119 ? ? -81.79 -73.98 26 7 TYR A 130 ? ? -114.72 -94.12 27 8 GLN A 91 ? ? 65.68 133.03 28 8 CYS A 98 ? ? -124.99 -161.43 29 8 ASP A 105 ? ? -126.94 -70.74 30 8 ILE A 113 ? ? -59.01 101.10 31 8 ARG A 120 ? ? -84.51 -90.74 32 8 GLU A 121 ? ? 176.86 55.60 33 8 CYS A 123 ? ? -172.03 135.92 34 9 CYS A 98 ? ? -135.48 -158.76 35 9 GLU A 104 ? ? -90.51 -60.94 36 9 THR A 128 ? ? -53.47 -88.38 37 10 GLN A 91 ? ? 50.63 -151.75 38 10 CYS A 98 ? ? -121.90 -169.04 39 10 SER A 103 ? ? -84.55 35.63 40 10 ILE A 113 ? ? -59.20 109.72 41 10 LYS A 119 ? ? -69.94 -71.75 42 10 GLU A 121 ? ? 52.48 74.03 43 10 THR A 128 ? ? -62.17 95.70 44 10 PRO A 144 ? ? -73.78 -162.59 # _pdbx_nmr_ensemble.entry_id 1G5V _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria ;back calculated data agree with experimental NOESY spectrum,structures with acceptable covalent geometry,structures with favorable non-bond energy,structures with the least restraint violations,structures with the lowest energy ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1G5V _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average,lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.0 mM 15N; 20mM phosphate buffer pH 6.3; 30mM NaCl; 5mM DTT' '90% H2O/10% D2O' 2 '1.0 mM 15N,13C; 20mM phosphate buffer pH 6.3; 30mM NaCl; 5mM DTT' '90% H2O/10% D2O' 3 '1.0 mM 15N,13C; 20mM phosphate buffer pH 6.3; 30mM NaCl; 5mM DTT' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20mM Phosphate 30mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 3 3 3D_13C-separated_NOESY 3 1 1 HNHA 4 1 1 'IPAP (dipolar couplings)' # _pdbx_nmr_refine.entry_id 1G5V _pdbx_nmr_refine.method 'mixed torsion and Cartesian angle dynamics simulated annealing protocol' _pdbx_nmr_refine.details '1402 Unambiguous NOE distance restraints 50 Hydrogen bond restraints 44 HN-N dipolar couplings' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection bruker 1 NMRPipe . processing 'Delaglio,F et al. J. Biomol.NMR 6 277-293(1995)' 2 XEASY . 'data analysis' 'Bartels et al. J.Biomol.NMR 5,1-10(1995)' 3 CNS 0.3 refinement 'bruenger et al. Acta Crystallogr.D Biol. Crystallogr. 54, 905-21 (1998)' 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 82 ? A LYS 1 2 1 Y 1 A LYS 83 ? A LYS 2 3 1 Y 1 A ASN 84 ? A ASN 3 4 1 Y 1 A THR 85 ? A THR 4 5 1 Y 1 A ALA 86 ? A ALA 5 6 1 Y 1 A ALA 87 ? A ALA 6 7 1 Y 1 A SER 88 ? A SER 7 8 1 Y 1 A LEU 89 ? A LEU 8 9 1 Y 1 A CYS 146 ? A CYS 65 10 1 Y 1 A GLU 147 ? A GLU 66 11 1 Y 1 A VAL 148 ? A VAL 67 12 1 Y 1 A ALA 149 ? A ALA 68 13 1 Y 1 A ASN 150 ? A ASN 69 14 1 Y 1 A ASN 151 ? A ASN 70 15 1 Y 1 A ILE 152 ? A ILE 71 16 1 Y 1 A GLU 153 ? A GLU 72 17 1 Y 1 A GLN 154 ? A GLN 73 18 1 Y 1 A ASN 155 ? A ASN 74 19 1 Y 1 A ALA 156 ? A ALA 75 20 1 Y 1 A GLN 157 ? A GLN 76 21 1 Y 1 A GLU 158 ? A GLU 77 22 1 Y 1 A ASN 159 ? A ASN 78 23 1 Y 1 A GLU 160 ? A GLU 79 24 1 Y 1 A ASN 161 ? A ASN 80 25 1 Y 1 A GLU 162 ? A GLU 81 26 1 Y 1 A SER 163 ? A SER 82 27 1 Y 1 A GLN 164 ? A GLN 83 28 1 Y 1 A VAL 165 ? A VAL 84 29 1 Y 1 A SER 166 ? A SER 85 30 1 Y 1 A THR 167 ? A THR 86 31 1 Y 1 A ASP 168 ? A ASP 87 32 1 Y 1 A GLU 169 ? A GLU 88 33 2 Y 1 A LYS 82 ? A LYS 1 34 2 Y 1 A LYS 83 ? A LYS 2 35 2 Y 1 A ASN 84 ? A ASN 3 36 2 Y 1 A THR 85 ? A THR 4 37 2 Y 1 A ALA 86 ? A ALA 5 38 2 Y 1 A ALA 87 ? A ALA 6 39 2 Y 1 A SER 88 ? A SER 7 40 2 Y 1 A LEU 89 ? A LEU 8 41 2 Y 1 A CYS 146 ? A CYS 65 42 2 Y 1 A GLU 147 ? A GLU 66 43 2 Y 1 A VAL 148 ? A VAL 67 44 2 Y 1 A ALA 149 ? A ALA 68 45 2 Y 1 A ASN 150 ? A ASN 69 46 2 Y 1 A ASN 151 ? A ASN 70 47 2 Y 1 A ILE 152 ? A ILE 71 48 2 Y 1 A GLU 153 ? A GLU 72 49 2 Y 1 A GLN 154 ? A GLN 73 50 2 Y 1 A ASN 155 ? A ASN 74 51 2 Y 1 A ALA 156 ? A ALA 75 52 2 Y 1 A GLN 157 ? A GLN 76 53 2 Y 1 A GLU 158 ? A GLU 77 54 2 Y 1 A ASN 159 ? A ASN 78 55 2 Y 1 A GLU 160 ? A GLU 79 56 2 Y 1 A ASN 161 ? A ASN 80 57 2 Y 1 A GLU 162 ? A GLU 81 58 2 Y 1 A SER 163 ? A SER 82 59 2 Y 1 A GLN 164 ? A GLN 83 60 2 Y 1 A VAL 165 ? A VAL 84 61 2 Y 1 A SER 166 ? A SER 85 62 2 Y 1 A THR 167 ? A THR 86 63 2 Y 1 A ASP 168 ? A ASP 87 64 2 Y 1 A GLU 169 ? A GLU 88 65 3 Y 1 A LYS 82 ? A LYS 1 66 3 Y 1 A LYS 83 ? A LYS 2 67 3 Y 1 A ASN 84 ? A ASN 3 68 3 Y 1 A THR 85 ? A THR 4 69 3 Y 1 A ALA 86 ? A ALA 5 70 3 Y 1 A ALA 87 ? A ALA 6 71 3 Y 1 A SER 88 ? A SER 7 72 3 Y 1 A LEU 89 ? A LEU 8 73 3 Y 1 A CYS 146 ? A CYS 65 74 3 Y 1 A GLU 147 ? A GLU 66 75 3 Y 1 A VAL 148 ? A VAL 67 76 3 Y 1 A ALA 149 ? A ALA 68 77 3 Y 1 A ASN 150 ? A ASN 69 78 3 Y 1 A ASN 151 ? A ASN 70 79 3 Y 1 A ILE 152 ? A ILE 71 80 3 Y 1 A GLU 153 ? A GLU 72 81 3 Y 1 A GLN 154 ? A GLN 73 82 3 Y 1 A ASN 155 ? A ASN 74 83 3 Y 1 A ALA 156 ? A ALA 75 84 3 Y 1 A GLN 157 ? A GLN 76 85 3 Y 1 A GLU 158 ? A GLU 77 86 3 Y 1 A ASN 159 ? A ASN 78 87 3 Y 1 A GLU 160 ? A GLU 79 88 3 Y 1 A ASN 161 ? A ASN 80 89 3 Y 1 A GLU 162 ? A GLU 81 90 3 Y 1 A SER 163 ? A SER 82 91 3 Y 1 A GLN 164 ? A GLN 83 92 3 Y 1 A VAL 165 ? A VAL 84 93 3 Y 1 A SER 166 ? A SER 85 94 3 Y 1 A THR 167 ? A THR 86 95 3 Y 1 A ASP 168 ? A ASP 87 96 3 Y 1 A GLU 169 ? A GLU 88 97 4 Y 1 A LYS 82 ? A LYS 1 98 4 Y 1 A LYS 83 ? A LYS 2 99 4 Y 1 A ASN 84 ? A ASN 3 100 4 Y 1 A THR 85 ? A THR 4 101 4 Y 1 A ALA 86 ? A ALA 5 102 4 Y 1 A ALA 87 ? A ALA 6 103 4 Y 1 A SER 88 ? A SER 7 104 4 Y 1 A LEU 89 ? A LEU 8 105 4 Y 1 A CYS 146 ? A CYS 65 106 4 Y 1 A GLU 147 ? A GLU 66 107 4 Y 1 A VAL 148 ? A VAL 67 108 4 Y 1 A ALA 149 ? A ALA 68 109 4 Y 1 A ASN 150 ? A ASN 69 110 4 Y 1 A ASN 151 ? A ASN 70 111 4 Y 1 A ILE 152 ? A ILE 71 112 4 Y 1 A GLU 153 ? A GLU 72 113 4 Y 1 A GLN 154 ? A GLN 73 114 4 Y 1 A ASN 155 ? A ASN 74 115 4 Y 1 A ALA 156 ? A ALA 75 116 4 Y 1 A GLN 157 ? A GLN 76 117 4 Y 1 A GLU 158 ? A GLU 77 118 4 Y 1 A ASN 159 ? A ASN 78 119 4 Y 1 A GLU 160 ? A GLU 79 120 4 Y 1 A ASN 161 ? A ASN 80 121 4 Y 1 A GLU 162 ? A GLU 81 122 4 Y 1 A SER 163 ? A SER 82 123 4 Y 1 A GLN 164 ? A GLN 83 124 4 Y 1 A VAL 165 ? A VAL 84 125 4 Y 1 A SER 166 ? A SER 85 126 4 Y 1 A THR 167 ? A THR 86 127 4 Y 1 A ASP 168 ? A ASP 87 128 4 Y 1 A GLU 169 ? A GLU 88 129 5 Y 1 A LYS 82 ? A LYS 1 130 5 Y 1 A LYS 83 ? A LYS 2 131 5 Y 1 A ASN 84 ? A ASN 3 132 5 Y 1 A THR 85 ? A THR 4 133 5 Y 1 A ALA 86 ? A ALA 5 134 5 Y 1 A ALA 87 ? A ALA 6 135 5 Y 1 A SER 88 ? A SER 7 136 5 Y 1 A LEU 89 ? A LEU 8 137 5 Y 1 A CYS 146 ? A CYS 65 138 5 Y 1 A GLU 147 ? A GLU 66 139 5 Y 1 A VAL 148 ? A VAL 67 140 5 Y 1 A ALA 149 ? A ALA 68 141 5 Y 1 A ASN 150 ? A ASN 69 142 5 Y 1 A ASN 151 ? A ASN 70 143 5 Y 1 A ILE 152 ? A ILE 71 144 5 Y 1 A GLU 153 ? A GLU 72 145 5 Y 1 A GLN 154 ? A GLN 73 146 5 Y 1 A ASN 155 ? A ASN 74 147 5 Y 1 A ALA 156 ? A ALA 75 148 5 Y 1 A GLN 157 ? A GLN 76 149 5 Y 1 A GLU 158 ? A GLU 77 150 5 Y 1 A ASN 159 ? A ASN 78 151 5 Y 1 A GLU 160 ? A GLU 79 152 5 Y 1 A ASN 161 ? A ASN 80 153 5 Y 1 A GLU 162 ? A GLU 81 154 5 Y 1 A SER 163 ? A SER 82 155 5 Y 1 A GLN 164 ? A GLN 83 156 5 Y 1 A VAL 165 ? A VAL 84 157 5 Y 1 A SER 166 ? A SER 85 158 5 Y 1 A THR 167 ? A THR 86 159 5 Y 1 A ASP 168 ? A ASP 87 160 5 Y 1 A GLU 169 ? A GLU 88 161 6 Y 1 A LYS 82 ? A LYS 1 162 6 Y 1 A LYS 83 ? A LYS 2 163 6 Y 1 A ASN 84 ? A ASN 3 164 6 Y 1 A THR 85 ? A THR 4 165 6 Y 1 A ALA 86 ? A ALA 5 166 6 Y 1 A ALA 87 ? A ALA 6 167 6 Y 1 A SER 88 ? A SER 7 168 6 Y 1 A LEU 89 ? A LEU 8 169 6 Y 1 A CYS 146 ? A CYS 65 170 6 Y 1 A GLU 147 ? A GLU 66 171 6 Y 1 A VAL 148 ? A VAL 67 172 6 Y 1 A ALA 149 ? A ALA 68 173 6 Y 1 A ASN 150 ? A ASN 69 174 6 Y 1 A ASN 151 ? A ASN 70 175 6 Y 1 A ILE 152 ? A ILE 71 176 6 Y 1 A GLU 153 ? A GLU 72 177 6 Y 1 A GLN 154 ? A GLN 73 178 6 Y 1 A ASN 155 ? A ASN 74 179 6 Y 1 A ALA 156 ? A ALA 75 180 6 Y 1 A GLN 157 ? A GLN 76 181 6 Y 1 A GLU 158 ? A GLU 77 182 6 Y 1 A ASN 159 ? A ASN 78 183 6 Y 1 A GLU 160 ? A GLU 79 184 6 Y 1 A ASN 161 ? A ASN 80 185 6 Y 1 A GLU 162 ? A GLU 81 186 6 Y 1 A SER 163 ? A SER 82 187 6 Y 1 A GLN 164 ? A GLN 83 188 6 Y 1 A VAL 165 ? A VAL 84 189 6 Y 1 A SER 166 ? A SER 85 190 6 Y 1 A THR 167 ? A THR 86 191 6 Y 1 A ASP 168 ? A ASP 87 192 6 Y 1 A GLU 169 ? A GLU 88 193 7 Y 1 A LYS 82 ? A LYS 1 194 7 Y 1 A LYS 83 ? A LYS 2 195 7 Y 1 A ASN 84 ? A ASN 3 196 7 Y 1 A THR 85 ? A THR 4 197 7 Y 1 A ALA 86 ? A ALA 5 198 7 Y 1 A ALA 87 ? A ALA 6 199 7 Y 1 A SER 88 ? A SER 7 200 7 Y 1 A LEU 89 ? A LEU 8 201 7 Y 1 A CYS 146 ? A CYS 65 202 7 Y 1 A GLU 147 ? A GLU 66 203 7 Y 1 A VAL 148 ? A VAL 67 204 7 Y 1 A ALA 149 ? A ALA 68 205 7 Y 1 A ASN 150 ? A ASN 69 206 7 Y 1 A ASN 151 ? A ASN 70 207 7 Y 1 A ILE 152 ? A ILE 71 208 7 Y 1 A GLU 153 ? A GLU 72 209 7 Y 1 A GLN 154 ? A GLN 73 210 7 Y 1 A ASN 155 ? A ASN 74 211 7 Y 1 A ALA 156 ? A ALA 75 212 7 Y 1 A GLN 157 ? A GLN 76 213 7 Y 1 A GLU 158 ? A GLU 77 214 7 Y 1 A ASN 159 ? A ASN 78 215 7 Y 1 A GLU 160 ? A GLU 79 216 7 Y 1 A ASN 161 ? A ASN 80 217 7 Y 1 A GLU 162 ? A GLU 81 218 7 Y 1 A SER 163 ? A SER 82 219 7 Y 1 A GLN 164 ? A GLN 83 220 7 Y 1 A VAL 165 ? A VAL 84 221 7 Y 1 A SER 166 ? A SER 85 222 7 Y 1 A THR 167 ? A THR 86 223 7 Y 1 A ASP 168 ? A ASP 87 224 7 Y 1 A GLU 169 ? A GLU 88 225 8 Y 1 A LYS 82 ? A LYS 1 226 8 Y 1 A LYS 83 ? A LYS 2 227 8 Y 1 A ASN 84 ? A ASN 3 228 8 Y 1 A THR 85 ? A THR 4 229 8 Y 1 A ALA 86 ? A ALA 5 230 8 Y 1 A ALA 87 ? A ALA 6 231 8 Y 1 A SER 88 ? A SER 7 232 8 Y 1 A LEU 89 ? A LEU 8 233 8 Y 1 A CYS 146 ? A CYS 65 234 8 Y 1 A GLU 147 ? A GLU 66 235 8 Y 1 A VAL 148 ? A VAL 67 236 8 Y 1 A ALA 149 ? A ALA 68 237 8 Y 1 A ASN 150 ? A ASN 69 238 8 Y 1 A ASN 151 ? A ASN 70 239 8 Y 1 A ILE 152 ? A ILE 71 240 8 Y 1 A GLU 153 ? A GLU 72 241 8 Y 1 A GLN 154 ? A GLN 73 242 8 Y 1 A ASN 155 ? A ASN 74 243 8 Y 1 A ALA 156 ? A ALA 75 244 8 Y 1 A GLN 157 ? A GLN 76 245 8 Y 1 A GLU 158 ? A GLU 77 246 8 Y 1 A ASN 159 ? A ASN 78 247 8 Y 1 A GLU 160 ? A GLU 79 248 8 Y 1 A ASN 161 ? A ASN 80 249 8 Y 1 A GLU 162 ? A GLU 81 250 8 Y 1 A SER 163 ? A SER 82 251 8 Y 1 A GLN 164 ? A GLN 83 252 8 Y 1 A VAL 165 ? A VAL 84 253 8 Y 1 A SER 166 ? A SER 85 254 8 Y 1 A THR 167 ? A THR 86 255 8 Y 1 A ASP 168 ? A ASP 87 256 8 Y 1 A GLU 169 ? A GLU 88 257 9 Y 1 A LYS 82 ? A LYS 1 258 9 Y 1 A LYS 83 ? A LYS 2 259 9 Y 1 A ASN 84 ? A ASN 3 260 9 Y 1 A THR 85 ? A THR 4 261 9 Y 1 A ALA 86 ? A ALA 5 262 9 Y 1 A ALA 87 ? A ALA 6 263 9 Y 1 A SER 88 ? A SER 7 264 9 Y 1 A LEU 89 ? A LEU 8 265 9 Y 1 A CYS 146 ? A CYS 65 266 9 Y 1 A GLU 147 ? A GLU 66 267 9 Y 1 A VAL 148 ? A VAL 67 268 9 Y 1 A ALA 149 ? A ALA 68 269 9 Y 1 A ASN 150 ? A ASN 69 270 9 Y 1 A ASN 151 ? A ASN 70 271 9 Y 1 A ILE 152 ? A ILE 71 272 9 Y 1 A GLU 153 ? A GLU 72 273 9 Y 1 A GLN 154 ? A GLN 73 274 9 Y 1 A ASN 155 ? A ASN 74 275 9 Y 1 A ALA 156 ? A ALA 75 276 9 Y 1 A GLN 157 ? A GLN 76 277 9 Y 1 A GLU 158 ? A GLU 77 278 9 Y 1 A ASN 159 ? A ASN 78 279 9 Y 1 A GLU 160 ? A GLU 79 280 9 Y 1 A ASN 161 ? A ASN 80 281 9 Y 1 A GLU 162 ? A GLU 81 282 9 Y 1 A SER 163 ? A SER 82 283 9 Y 1 A GLN 164 ? A GLN 83 284 9 Y 1 A VAL 165 ? A VAL 84 285 9 Y 1 A SER 166 ? A SER 85 286 9 Y 1 A THR 167 ? A THR 86 287 9 Y 1 A ASP 168 ? A ASP 87 288 9 Y 1 A GLU 169 ? A GLU 88 289 10 Y 1 A LYS 82 ? A LYS 1 290 10 Y 1 A LYS 83 ? A LYS 2 291 10 Y 1 A ASN 84 ? A ASN 3 292 10 Y 1 A THR 85 ? A THR 4 293 10 Y 1 A ALA 86 ? A ALA 5 294 10 Y 1 A ALA 87 ? A ALA 6 295 10 Y 1 A SER 88 ? A SER 7 296 10 Y 1 A LEU 89 ? A LEU 8 297 10 Y 1 A CYS 146 ? A CYS 65 298 10 Y 1 A GLU 147 ? A GLU 66 299 10 Y 1 A VAL 148 ? A VAL 67 300 10 Y 1 A ALA 149 ? A ALA 68 301 10 Y 1 A ASN 150 ? A ASN 69 302 10 Y 1 A ASN 151 ? A ASN 70 303 10 Y 1 A ILE 152 ? A ILE 71 304 10 Y 1 A GLU 153 ? A GLU 72 305 10 Y 1 A GLN 154 ? A GLN 73 306 10 Y 1 A ASN 155 ? A ASN 74 307 10 Y 1 A ALA 156 ? A ALA 75 308 10 Y 1 A GLN 157 ? A GLN 76 309 10 Y 1 A GLU 158 ? A GLU 77 310 10 Y 1 A ASN 159 ? A ASN 78 311 10 Y 1 A GLU 160 ? A GLU 79 312 10 Y 1 A ASN 161 ? A ASN 80 313 10 Y 1 A GLU 162 ? A GLU 81 314 10 Y 1 A SER 163 ? A SER 82 315 10 Y 1 A GLN 164 ? A GLN 83 316 10 Y 1 A VAL 165 ? A VAL 84 317 10 Y 1 A SER 166 ? A SER 85 318 10 Y 1 A THR 167 ? A THR 86 319 10 Y 1 A ASP 168 ? A ASP 87 320 10 Y 1 A GLU 169 ? A GLU 88 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 PHE N N N N 206 PHE CA C N S 207 PHE C C N N 208 PHE O O N N 209 PHE CB C N N 210 PHE CG C Y N 211 PHE CD1 C Y N 212 PHE CD2 C Y N 213 PHE CE1 C Y N 214 PHE CE2 C Y N 215 PHE CZ C Y N 216 PHE OXT O N N 217 PHE H H N N 218 PHE H2 H N N 219 PHE HA H N N 220 PHE HB2 H N N 221 PHE HB3 H N N 222 PHE HD1 H N N 223 PHE HD2 H N N 224 PHE HE1 H N N 225 PHE HE2 H N N 226 PHE HZ H N N 227 PHE HXT H N N 228 PRO N N N N 229 PRO CA C N S 230 PRO C C N N 231 PRO O O N N 232 PRO CB C N N 233 PRO CG C N N 234 PRO CD C N N 235 PRO OXT O N N 236 PRO H H N N 237 PRO HA H N N 238 PRO HB2 H N N 239 PRO HB3 H N N 240 PRO HG2 H N N 241 PRO HG3 H N N 242 PRO HD2 H N N 243 PRO HD3 H N N 244 PRO HXT H N N 245 SER N N N N 246 SER CA C N S 247 SER C C N N 248 SER O O N N 249 SER CB C N N 250 SER OG O N N 251 SER OXT O N N 252 SER H H N N 253 SER H2 H N N 254 SER HA H N N 255 SER HB2 H N N 256 SER HB3 H N N 257 SER HG H N N 258 SER HXT H N N 259 THR N N N N 260 THR CA C N S 261 THR C C N N 262 THR O O N N 263 THR CB C N R 264 THR OG1 O N N 265 THR CG2 C N N 266 THR OXT O N N 267 THR H H N N 268 THR H2 H N N 269 THR HA H N N 270 THR HB H N N 271 THR HG1 H N N 272 THR HG21 H N N 273 THR HG22 H N N 274 THR HG23 H N N 275 THR HXT H N N 276 TRP N N N N 277 TRP CA C N S 278 TRP C C N N 279 TRP O O N N 280 TRP CB C N N 281 TRP CG C Y N 282 TRP CD1 C Y N 283 TRP CD2 C Y N 284 TRP NE1 N Y N 285 TRP CE2 C Y N 286 TRP CE3 C Y N 287 TRP CZ2 C Y N 288 TRP CZ3 C Y N 289 TRP CH2 C Y N 290 TRP OXT O N N 291 TRP H H N N 292 TRP H2 H N N 293 TRP HA H N N 294 TRP HB2 H N N 295 TRP HB3 H N N 296 TRP HD1 H N N 297 TRP HE1 H N N 298 TRP HE3 H N N 299 TRP HZ2 H N N 300 TRP HZ3 H N N 301 TRP HH2 H N N 302 TRP HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TRP N CA sing N N 264 TRP N H sing N N 265 TRP N H2 sing N N 266 TRP CA C sing N N 267 TRP CA CB sing N N 268 TRP CA HA sing N N 269 TRP C O doub N N 270 TRP C OXT sing N N 271 TRP CB CG sing N N 272 TRP CB HB2 sing N N 273 TRP CB HB3 sing N N 274 TRP CG CD1 doub Y N 275 TRP CG CD2 sing Y N 276 TRP CD1 NE1 sing Y N 277 TRP CD1 HD1 sing N N 278 TRP CD2 CE2 doub Y N 279 TRP CD2 CE3 sing Y N 280 TRP NE1 CE2 sing Y N 281 TRP NE1 HE1 sing N N 282 TRP CE2 CZ2 sing Y N 283 TRP CE3 CZ3 doub Y N 284 TRP CE3 HE3 sing N N 285 TRP CZ2 CH2 doub Y N 286 TRP CZ2 HZ2 sing N N 287 TRP CZ3 CH2 sing Y N 288 TRP CZ3 HZ3 sing N N 289 TRP CH2 HH2 sing N N 290 TRP OXT HXT sing N N 291 TYR N CA sing N N 292 TYR N H sing N N 293 TYR N H2 sing N N 294 TYR CA C sing N N 295 TYR CA CB sing N N 296 TYR CA HA sing N N 297 TYR C O doub N N 298 TYR C OXT sing N N 299 TYR CB CG sing N N 300 TYR CB HB2 sing N N 301 TYR CB HB3 sing N N 302 TYR CG CD1 doub Y N 303 TYR CG CD2 sing Y N 304 TYR CD1 CE1 sing Y N 305 TYR CD1 HD1 sing N N 306 TYR CD2 CE2 doub Y N 307 TYR CD2 HD2 sing N N 308 TYR CE1 CZ doub Y N 309 TYR CE1 HE1 sing N N 310 TYR CE2 CZ sing Y N 311 TYR CE2 HE2 sing N N 312 TYR CZ OH sing N N 313 TYR OH HH sing N N 314 TYR OXT HXT sing N N 315 VAL N CA sing N N 316 VAL N H sing N N 317 VAL N H2 sing N N 318 VAL CA C sing N N 319 VAL CA CB sing N N 320 VAL CA HA sing N N 321 VAL C O doub N N 322 VAL C OXT sing N N 323 VAL CB CG1 sing N N 324 VAL CB CG2 sing N N 325 VAL CB HB sing N N 326 VAL CG1 HG11 sing N N 327 VAL CG1 HG12 sing N N 328 VAL CG1 HG13 sing N N 329 VAL CG2 HG21 sing N N 330 VAL CG2 HG22 sing N N 331 VAL CG2 HG23 sing N N 332 VAL OXT HXT sing N N 333 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 600 # _atom_sites.entry_id 1G5V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_