data_1H9C # _entry.id 1H9C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1H9C PDBE EBI-5879 WWPDB D_1290005879 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1H9C _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2001-03-07 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ab, E.' 1 ? 'Schuurman-Wolters, G.K.' 2 ? 'Nijlant, D.' 3 ? 'Dijkstra, K.' 4 ? 'Saier, M.H.' 5 ? 'Robillard, G.T.' 6 ? 'Scheek, R.M.' 7 ? # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR Structure of Cysteinyl-Phosphorylated Enzyme Iib of the N,N'-Diacetylchitobiose Specific Phosphoenolpyruvate-Dependentphosphotransferase System of Escherichia Coli ; J.Mol.Biol. 308 993 1009 2001 JMOBAK UK 0022-2836 0070 ? 11352587 10.1006/JMBI.2001.4623 1 ;The NMR Side-Chain Assignments and Solution Structure of Enzyme Iibcellobiose of the Phosphoenolpyruvate-Dependent Phosphotransferase System of Escherichia Coli ; 'Protein Sci.' 6 304 314 1997 PRCIEI US 0961-8368 0795 ? 9041631 10.1002/pro.5560060205 2 ;Enzyme Iibcellobiose of the Phosphoenol-Pyruvate-Dependent Phosphotransferase System of Escherichia Coli: Backbone Assignment and Secondary Structure Determined by Three-Dimensional NMR Spectroscopy ; 'Protein Sci.' 3 282 290 1994 PRCIEI US 0961-8368 0795 ? 8003964 10.1002/pro.5560030212 3 'Characterization and Nucleotide Sequence of the Cryptic Cel Operon of Escherichia Coli K12' Genetics 124 455 471 1990 ? US 0016-6731 ? ? 2179047 ? 4 ;The Cellobiose Permease of Escherichia Coli Consists of Three Proteins and is Homologous to the Lactose Permease of Staphylococcus Aureus ; Res.Microbiol. 141 1061 1067 1990 RMCREW FR 0923-2508 2114 ? 2092358 '10.1016/0923-2508(90)90079-6' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Ab, E.' 1 primary 'Schuurman-Wolters, G.K.' 2 primary 'Nijlant, D.' 3 primary 'Dijkstra, K.' 4 primary 'Saier, M.H.' 5 primary 'Robillard, G.T.' 6 primary 'Scheek, R.M.' 7 1 'Ab, E.' 8 1 'Schuurman-Wolters, G.' 9 1 'Reizer, J.' 10 1 'Saier, M.H.' 11 1 'Dijkstra, K.' 12 1 'Scheek, R.M.' 13 1 'Robillard, G.T.' 14 2 'Ab, E.' 15 2 'Schuurman-Wolters, G.K.' 16 2 'Saier, M.H.' 17 2 'Reizer, J.' 18 2 'Jacuinod, M.' 19 2 'Roepstorff, P.' 20 2 'Dijkstra, K.' 21 2 'Scheek, R.M.' 22 2 'Robillard, G.T.' 23 3 'Parker, L.L.' 24 3 'Hall, B.G.' 25 4 'Reizer, J.' 26 4 'Reizer, A.' 27 4 'Saier Jr, M.H.' 28 # _cell.entry_id 1H9C _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1H9C _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT' _entity.formula_weight 11519.493 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.69 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'PHOSPHORYLATION AT RESIDUE CYS10' # _entity_name_com.entity_id 1 _entity_name_com.name 'EIIB-CEL, EIIB-CHB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MEKKHIYLF(CSP)SAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPV EVIDSLLYGKVDGLGVLKAAVAAIKKAAAN ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVID SLLYGKVDGLGVLKAAVAAIKKAAAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 LYS n 1 5 HIS n 1 6 ILE n 1 7 TYR n 1 8 LEU n 1 9 PHE n 1 10 CSP n 1 11 SER n 1 12 ALA n 1 13 GLY n 1 14 MET n 1 15 SER n 1 16 THR n 1 17 SER n 1 18 LEU n 1 19 LEU n 1 20 VAL n 1 21 SER n 1 22 LYS n 1 23 MET n 1 24 ARG n 1 25 ALA n 1 26 GLN n 1 27 ALA n 1 28 GLU n 1 29 LYS n 1 30 TYR n 1 31 GLU n 1 32 VAL n 1 33 PRO n 1 34 VAL n 1 35 ILE n 1 36 ILE n 1 37 GLU n 1 38 ALA n 1 39 PHE n 1 40 PRO n 1 41 GLU n 1 42 THR n 1 43 LEU n 1 44 ALA n 1 45 GLY n 1 46 GLU n 1 47 LYS n 1 48 GLY n 1 49 GLN n 1 50 ASN n 1 51 ALA n 1 52 ASP n 1 53 VAL n 1 54 VAL n 1 55 LEU n 1 56 LEU n 1 57 GLY n 1 58 PRO n 1 59 GLN n 1 60 ILE n 1 61 ALA n 1 62 TYR n 1 63 MET n 1 64 LEU n 1 65 PRO n 1 66 GLU n 1 67 ILE n 1 68 GLN n 1 69 ARG n 1 70 LEU n 1 71 LEU n 1 72 PRO n 1 73 ASN n 1 74 LYS n 1 75 PRO n 1 76 VAL n 1 77 GLU n 1 78 VAL n 1 79 ILE n 1 80 ASP n 1 81 SER n 1 82 LEU n 1 83 LEU n 1 84 TYR n 1 85 GLY n 1 86 LYS n 1 87 VAL n 1 88 ASP n 1 89 GLY n 1 90 LEU n 1 91 GLY n 1 92 VAL n 1 93 LEU n 1 94 LYS n 1 95 ALA n 1 96 ALA n 1 97 VAL n 1 98 ALA n 1 99 ALA n 1 100 ILE n 1 101 LYS n 1 102 LYS n 1 103 ALA n 1 104 ALA n 1 105 ALA n 1 106 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CHBB [PREV CELA]' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain W3110 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 316407 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location CYTOPLASM _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 316407 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain W3110 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PJR-BLIIB _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTCB_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P17409 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1H9C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17409 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1H9C _struct_ref_seq_dif.mon_id CSP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 10 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P17409 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 10 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 10 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSP 'L-peptide linking' n S-PHOSPHOCYSTEINE ? 'C3 H8 N O5 P S' 201.138 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type NOESY _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 1H9C _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, RESTRAINED MOLECULAR DYNAMICS, SIMULATED ANNEALING' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1H9C _pdbx_nmr_ensemble.conformers_calculated_total_number 33 _pdbx_nmr_ensemble.conformers_submitted_total_number 9 _pdbx_nmr_ensemble.conformer_selection_criteria 'TARGET-FUNCTION, R-FACTOR, NUMBER OF VIOLATIONS' # _pdbx_nmr_representative.entry_id 1H9C _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement GROMACS ? 'VAN DER SPOEL' 1 'structure solution' SNARF ? ? 2 'structure solution' DDD ? ? 3 'structure solution' GROMACS ? ? 4 # _exptl.entry_id 1H9C _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1H9C _struct.title ;NMR structure of cysteinyl-phosphorylated enzyme IIB of the N,N'-diacetylchitobiose specific phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli. ; _struct.pdbx_descriptor 'PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT (E.C.2.7.1.69)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1H9C _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'TRANSFERASE, ENZYME IIB-CHITOBIOSE, PHOSPHOTRANSFERASE SYSTEM, SUGAR TRANSPORT, PHOSPHORYLATION, IIB- CELLOBIOSE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 16 ? TYR A 30 ? THR A 16 TYR A 30 1 ? 15 HELX_P HELX_P2 2 LEU A 43 ? GLN A 49 ? LEU A 43 GLN A 49 1 ? 7 HELX_P HELX_P3 3 PRO A 58 ? TYR A 62 ? PRO A 58 TYR A 62 5 ? 5 HELX_P HELX_P4 4 MET A 63 ? LEU A 71 ? MET A 63 LEU A 71 1 ? 9 HELX_P HELX_P5 5 ASP A 80 ? VAL A 87 ? ASP A 80 VAL A 87 1 ? 8 HELX_P HELX_P6 6 ASP A 88 ? ALA A 105 ? ASP A 88 ALA A 105 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A PHE 9 C ? ? ? 1_555 A CSP 10 N ? ? A PHE 9 A CSP 10 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A CSP 10 C ? ? ? 1_555 A SER 11 N ? ? A CSP 10 A SER 11 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 34 ? PRO A 40 ? VAL A 34 PRO A 40 AA 2 LYS A 4 ? CSP A 10 ? LYS A 4 CSP A 10 AA 3 VAL A 53 ? LEU A 56 ? VAL A 53 LEU A 56 AA 4 VAL A 76 ? VAL A 78 ? VAL A 76 VAL A 78 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N ILE A 35 ? N ILE A 35 O LYS A 4 ? O LYS A 4 AA 2 3 N TYR A 7 ? N TYR A 7 O VAL A 53 ? O VAL A 53 AA 3 4 N LEU A 56 ? N LEU A 56 O GLU A 77 ? O GLU A 77 # _database_PDB_matrix.entry_id 1H9C _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1H9C _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 CSP 10 10 10 CSP CSP A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 TYR 84 84 84 TYR TYR A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ASN 106 106 106 ASN ASN A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id CSP _pdbx_struct_mod_residue.label_seq_id 10 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id CSP _pdbx_struct_mod_residue.auth_seq_id 10 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id CYS _pdbx_struct_mod_residue.details S-PHOSPHOCYSTEINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-05-21 2 'Structure model' 1 1 2011-05-07 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' entity_src_gen 4 4 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_volume' 2 4 'Structure model' '_citation.page_last' 3 4 'Structure model' '_citation.pdbx_database_id_DOI' 4 4 'Structure model' '_citation_author.name' 5 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 6 4 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_entry_details.entry_id 1H9C _pdbx_entry_details.compound_details ;COMPONENT OF THE PHOSPHOENOLPYRUVATE-DEPENDENT SUGAR PHOSPHOTRANSFERASE SYSTEM (PTS) ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 115.19 121.00 -5.81 0.60 N 2 1 CB A TYR 30 ? ? CG A TYR 30 ? ? CD2 A TYR 30 ? ? 116.68 121.00 -4.32 0.60 N 3 2 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 116.04 121.00 -4.96 0.60 N 4 3 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 114.85 121.00 -6.15 0.60 N 5 4 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 115.05 121.00 -5.95 0.60 N 6 5 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 114.80 121.00 -6.20 0.60 N 7 6 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 114.90 121.00 -6.10 0.60 N 8 7 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 115.54 121.00 -5.46 0.60 N 9 8 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 115.15 121.00 -5.85 0.60 N 10 9 CB A TYR 7 ? ? CG A TYR 7 ? ? CD2 A TYR 7 ? ? 114.69 121.00 -6.31 0.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 31 ? ? 31.95 56.92 2 1 ALA A 105 ? ? -163.27 -169.09 3 2 MET A 14 ? ? -115.25 -71.15 4 2 GLU A 31 ? ? 29.28 63.19 5 2 ALA A 105 ? ? 137.45 94.92 6 3 GLU A 31 ? ? 28.31 64.85 7 3 VAL A 87 ? ? 58.35 70.22 8 3 ALA A 104 ? ? -68.05 -73.99 9 3 ALA A 105 ? ? -169.15 87.09 10 4 LYS A 3 ? ? 63.23 146.98 11 4 ALA A 104 ? ? -91.88 33.39 12 4 ALA A 105 ? ? 59.61 105.83 13 5 GLU A 31 ? ? 22.57 68.29 14 5 ALA A 105 ? ? -104.19 59.39 15 6 GLU A 2 ? ? 64.20 126.65 16 6 GLU A 31 ? ? 28.07 58.31 17 6 VAL A 87 ? ? 39.14 59.29 18 6 ALA A 104 ? ? 62.85 -32.61 19 6 ALA A 105 ? ? 120.56 128.82 20 7 MET A 14 ? ? -106.34 -72.36 21 7 GLU A 31 ? ? 32.47 65.05 22 7 LYS A 101 ? ? 57.24 -41.22 23 7 LYS A 102 ? ? 111.77 84.22 24 7 ALA A 104 ? ? 48.37 76.01 25 7 ALA A 105 ? ? 28.39 76.43 26 8 GLU A 2 ? ? 62.41 78.05 27 8 GLU A 31 ? ? 29.53 69.20 28 8 ALA A 105 ? ? 159.92 98.97 29 9 LYS A 3 ? ? 67.53 147.60 30 9 MET A 14 ? ? -101.60 -71.37 31 9 GLU A 31 ? ? 30.32 69.76 32 9 LYS A 101 ? ? -61.56 1.09 33 9 LYS A 102 ? ? 75.33 70.48 34 9 ALA A 105 ? ? 28.14 81.25 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 ILE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 100 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 101 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -147.93 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 GLY A 45 ? ? -11.12 2 5 GLY A 45 ? ? -11.68 3 6 GLU A 46 ? ? -10.61 4 7 ARG A 24 ? ? -10.30 5 7 GLY A 45 ? ? -10.52 6 7 LYS A 101 ? ? 12.29 7 9 GLY A 45 ? ? -11.96 8 9 GLU A 46 ? ? -10.35 9 9 ALA A 104 ? ? -11.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 30 ? ? 0.084 'SIDE CHAIN' 2 1 TYR A 84 ? ? 0.074 'SIDE CHAIN' 3 2 TYR A 7 ? ? 0.070 'SIDE CHAIN' 4 3 TYR A 7 ? ? 0.075 'SIDE CHAIN' 5 3 TYR A 30 ? ? 0.069 'SIDE CHAIN' 6 4 TYR A 7 ? ? 0.066 'SIDE CHAIN' 7 5 TYR A 7 ? ? 0.065 'SIDE CHAIN' 8 7 TYR A 7 ? ? 0.075 'SIDE CHAIN' 9 8 TYR A 7 ? ? 0.069 'SIDE CHAIN' 10 9 TYR A 84 ? ? 0.077 'SIDE CHAIN' #