data_1HJN # _entry.id 1HJN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HJN pdb_00001hjn 10.2210/pdb1hjn/pdb PDBE EBI-12263 ? ? WWPDB D_1290012263 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-03 2 'Structure model' 1 1 2011-05-08 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HJN _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2003-02-27 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1E1G unspecified 'HUMAN PRION PROTEIN VARIANT M166V' PDB 1E1J unspecified 'HUMAN PRION PROTEIN VARIANT M166V' PDB 1E1P unspecified 'HUMAN PRION PROTEIN VARIANT S170N' PDB 1E1S unspecified 'HUMAN PRION PROTEIN VARIANT S170N' PDB 1E1U unspecified 'HUMAN PRION PROTEIN VARIANT R220K' PDB 1E1W unspecified 'HUMAN PRION PROTEIN VARIANT R220K' PDB 1HJM unspecified 'HUMAN PRION PROTEIN AT PH 7.0' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Calzolai, L.' 1 'Zahn, R.' 2 # _citation.id primary _citation.title 'Influence of Ph on NMR Structure and Stability of the Human Prion Protein Globular Domain' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 35592 _citation.page_last ? _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12826672 _citation.pdbx_database_id_DOI 10.1074/JBC.M303005200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Calzolai, L.' 1 ? primary 'Zahn, R.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'MAJOR PRION PROTEIN PRECURSOR' _entity.formula_weight 12559.972 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'GLOBULAR DOMAIN, RESIDUES 125-228' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PRP, PRP27-30, PRP33-35C, ASCR, CD230 ANTIGEN' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;LGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVK MMERVVEQMCITQYERESQAYYQR ; _entity_poly.pdbx_seq_one_letter_code_can ;LGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVK MMERVVEQMCITQYERESQAYYQR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLY n 1 3 GLY n 1 4 TYR n 1 5 MET n 1 6 LEU n 1 7 GLY n 1 8 SER n 1 9 ALA n 1 10 MET n 1 11 SER n 1 12 ARG n 1 13 PRO n 1 14 ILE n 1 15 ILE n 1 16 HIS n 1 17 PHE n 1 18 GLY n 1 19 SER n 1 20 ASP n 1 21 TYR n 1 22 GLU n 1 23 ASP n 1 24 ARG n 1 25 TYR n 1 26 TYR n 1 27 ARG n 1 28 GLU n 1 29 ASN n 1 30 MET n 1 31 HIS n 1 32 ARG n 1 33 TYR n 1 34 PRO n 1 35 ASN n 1 36 GLN n 1 37 VAL n 1 38 TYR n 1 39 TYR n 1 40 ARG n 1 41 PRO n 1 42 MET n 1 43 ASP n 1 44 GLU n 1 45 TYR n 1 46 SER n 1 47 ASN n 1 48 GLN n 1 49 ASN n 1 50 ASN n 1 51 PHE n 1 52 VAL n 1 53 HIS n 1 54 ASP n 1 55 CYS n 1 56 VAL n 1 57 ASN n 1 58 ILE n 1 59 THR n 1 60 ILE n 1 61 LYS n 1 62 GLN n 1 63 HIS n 1 64 THR n 1 65 VAL n 1 66 THR n 1 67 THR n 1 68 THR n 1 69 THR n 1 70 LYS n 1 71 GLY n 1 72 GLU n 1 73 ASN n 1 74 PHE n 1 75 THR n 1 76 GLU n 1 77 THR n 1 78 ASP n 1 79 VAL n 1 80 LYS n 1 81 MET n 1 82 MET n 1 83 GLU n 1 84 ARG n 1 85 VAL n 1 86 VAL n 1 87 GLU n 1 88 GLN n 1 89 MET n 1 90 CYS n 1 91 ILE n 1 92 THR n 1 93 GLN n 1 94 TYR n 1 95 GLU n 1 96 ARG n 1 97 GLU n 1 98 SER n 1 99 GLN n 1 100 ALA n 1 101 TYR n 1 102 TYR n 1 103 GLN n 1 104 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HUMAN _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'HOMO SAPIENS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 125 125 LEU LEU A . n A 1 2 GLY 2 126 126 GLY GLY A . n A 1 3 GLY 3 127 127 GLY GLY A . n A 1 4 TYR 4 128 128 TYR TYR A . n A 1 5 MET 5 129 129 MET MET A . n A 1 6 LEU 6 130 130 LEU LEU A . n A 1 7 GLY 7 131 131 GLY GLY A . n A 1 8 SER 8 132 132 SER SER A . n A 1 9 ALA 9 133 133 ALA ALA A . n A 1 10 MET 10 134 134 MET MET A . n A 1 11 SER 11 135 135 SER SER A . n A 1 12 ARG 12 136 136 ARG ARG A . n A 1 13 PRO 13 137 137 PRO PRO A . n A 1 14 ILE 14 138 138 ILE ILE A . n A 1 15 ILE 15 139 139 ILE ILE A . n A 1 16 HIS 16 140 140 HIS HIS A . n A 1 17 PHE 17 141 141 PHE PHE A . n A 1 18 GLY 18 142 142 GLY GLY A . n A 1 19 SER 19 143 143 SER SER A . n A 1 20 ASP 20 144 144 ASP ASP A . n A 1 21 TYR 21 145 145 TYR TYR A . n A 1 22 GLU 22 146 146 GLU GLU A . n A 1 23 ASP 23 147 147 ASP ASP A . n A 1 24 ARG 24 148 148 ARG ARG A . n A 1 25 TYR 25 149 149 TYR TYR A . n A 1 26 TYR 26 150 150 TYR TYR A . n A 1 27 ARG 27 151 151 ARG ARG A . n A 1 28 GLU 28 152 152 GLU GLU A . n A 1 29 ASN 29 153 153 ASN ASN A . n A 1 30 MET 30 154 154 MET MET A . n A 1 31 HIS 31 155 155 HIS HIS A . n A 1 32 ARG 32 156 156 ARG ARG A . n A 1 33 TYR 33 157 157 TYR TYR A . n A 1 34 PRO 34 158 158 PRO PRO A . n A 1 35 ASN 35 159 159 ASN ASN A . n A 1 36 GLN 36 160 160 GLN GLN A . n A 1 37 VAL 37 161 161 VAL VAL A . n A 1 38 TYR 38 162 162 TYR TYR A . n A 1 39 TYR 39 163 163 TYR TYR A . n A 1 40 ARG 40 164 164 ARG ARG A . n A 1 41 PRO 41 165 165 PRO PRO A . n A 1 42 MET 42 166 166 MET MET A . n A 1 43 ASP 43 167 167 ASP ASP A . n A 1 44 GLU 44 168 168 GLU GLU A . n A 1 45 TYR 45 169 169 TYR TYR A . n A 1 46 SER 46 170 170 SER SER A . n A 1 47 ASN 47 171 171 ASN ASN A . n A 1 48 GLN 48 172 172 GLN GLN A . n A 1 49 ASN 49 173 173 ASN ASN A . n A 1 50 ASN 50 174 174 ASN ASN A . n A 1 51 PHE 51 175 175 PHE PHE A . n A 1 52 VAL 52 176 176 VAL VAL A . n A 1 53 HIS 53 177 177 HIS HIS A . n A 1 54 ASP 54 178 178 ASP ASP A . n A 1 55 CYS 55 179 179 CYS CYS A . n A 1 56 VAL 56 180 180 VAL VAL A . n A 1 57 ASN 57 181 181 ASN ASN A . n A 1 58 ILE 58 182 182 ILE ILE A . n A 1 59 THR 59 183 183 THR THR A . n A 1 60 ILE 60 184 184 ILE ILE A . n A 1 61 LYS 61 185 185 LYS LYS A . n A 1 62 GLN 62 186 186 GLN GLN A . n A 1 63 HIS 63 187 187 HIS HIS A . n A 1 64 THR 64 188 188 THR THR A . n A 1 65 VAL 65 189 189 VAL VAL A . n A 1 66 THR 66 190 190 THR THR A . n A 1 67 THR 67 191 191 THR THR A . n A 1 68 THR 68 192 192 THR THR A . n A 1 69 THR 69 193 193 THR THR A . n A 1 70 LYS 70 194 194 LYS LYS A . n A 1 71 GLY 71 195 195 GLY GLY A . n A 1 72 GLU 72 196 196 GLU GLU A . n A 1 73 ASN 73 197 197 ASN ASN A . n A 1 74 PHE 74 198 198 PHE PHE A . n A 1 75 THR 75 199 199 THR THR A . n A 1 76 GLU 76 200 200 GLU GLU A . n A 1 77 THR 77 201 201 THR THR A . n A 1 78 ASP 78 202 202 ASP ASP A . n A 1 79 VAL 79 203 203 VAL VAL A . n A 1 80 LYS 80 204 204 LYS LYS A . n A 1 81 MET 81 205 205 MET MET A . n A 1 82 MET 82 206 206 MET MET A . n A 1 83 GLU 83 207 207 GLU GLU A . n A 1 84 ARG 84 208 208 ARG ARG A . n A 1 85 VAL 85 209 209 VAL VAL A . n A 1 86 VAL 86 210 210 VAL VAL A . n A 1 87 GLU 87 211 211 GLU GLU A . n A 1 88 GLN 88 212 212 GLN GLN A . n A 1 89 MET 89 213 213 MET MET A . n A 1 90 CYS 90 214 214 CYS CYS A . n A 1 91 ILE 91 215 215 ILE ILE A . n A 1 92 THR 92 216 216 THR THR A . n A 1 93 GLN 93 217 217 GLN GLN A . n A 1 94 TYR 94 218 218 TYR TYR A . n A 1 95 GLU 95 219 219 GLU GLU A . n A 1 96 ARG 96 220 220 ARG ARG A . n A 1 97 GLU 97 221 221 GLU GLU A . n A 1 98 SER 98 222 222 SER SER A . n A 1 99 GLN 99 223 223 GLN GLN A . n A 1 100 ALA 100 224 224 ALA ALA A . n A 1 101 TYR 101 225 225 TYR TYR A . n A 1 102 TYR 102 226 226 TYR TYR A . n A 1 103 GLN 103 227 227 GLN GLN A . n A 1 104 ARG 104 228 228 ARG ARG A . n # _cell.entry_id 1HJN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HJN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1HJN _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1HJN _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1HJN _struct.title 'HUMAN PRION PROTEIN AT PH 7.0' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HJN _struct_keywords.pdbx_keywords 'PRION PROTEIN' _struct_keywords.text 'PRION PROTEIN, PRION, BRAIN, GLYCOPROTEIN, GPI-ANCHOR' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P04156 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HJN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04156 _struct_ref_seq.db_align_beg 125 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 125 _struct_ref_seq.pdbx_auth_seq_align_end 228 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? MET A 30 ? SER A 143 MET A 154 1 ? 12 HELX_P HELX_P2 2 HIS A 31 ? TYR A 33 ? HIS A 155 TYR A 157 5 ? 3 HELX_P HELX_P3 3 GLN A 48 ? GLY A 71 ? GLN A 172 GLY A 195 1 ? 24 HELX_P HELX_P4 4 THR A 75 ? ARG A 104 ? THR A 199 ARG A 228 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 55 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 90 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 179 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 214 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.046 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 55 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 90 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 179 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 214 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 MET A 5 ? ALA A 9 ? MET A 129 ALA A 133 AA 2 GLN A 36 ? TYR A 39 ? GLN A 160 TYR A 163 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 7 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 131 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 37 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 161 # _pdbx_entry_details.entry_id 1HJN _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH A TYR 128 ? ? OD1 A ASP 178 ? ? 1.59 2 4 O A THR 188 ? ? HG1 A THR 191 ? ? 1.60 3 6 OE1 A GLU 219 ? ? HG A SER 222 ? ? 1.56 4 8 HH A TYR 128 ? ? OD1 A ASP 178 ? ? 1.55 5 9 HH A TYR 128 ? ? OD2 A ASP 178 ? ? 1.57 6 9 O A VAL 189 ? ? HG1 A THR 192 ? ? 1.59 7 10 HH A TYR 128 ? ? OD2 A ASP 178 ? ? 1.60 8 11 HH A TYR 163 ? ? OE2 A GLU 221 ? ? 1.58 9 12 HH A TYR 157 ? ? OD1 A ASP 202 ? ? 1.56 10 14 HH A TYR 128 ? ? OD1 A ASP 178 ? ? 1.57 11 15 HH A TYR 128 ? ? OD1 A ASP 178 ? ? 1.53 12 15 O A VAL 189 ? ? HG1 A THR 192 ? ? 1.60 13 17 HH A TYR 128 ? ? OD1 A ASP 178 ? ? 1.47 14 17 O A VAL 189 ? ? HG1 A THR 192 ? ? 1.56 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 5 NE A ARG 148 ? ? CZ A ARG 148 ? ? NH1 A ARG 148 ? ? 123.54 120.30 3.24 0.50 N 2 10 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 117.13 120.30 -3.17 0.50 N 3 11 CB A TYR 163 ? ? CG A TYR 163 ? ? CD2 A TYR 163 ? ? 116.90 121.00 -4.10 0.60 N 4 12 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 121.70 114.20 7.50 1.10 N 5 16 NE A ARG 136 ? ? CZ A ARG 136 ? ? NH2 A ARG 136 ? ? 116.94 120.30 -3.36 0.50 N 6 19 NE A ARG 164 ? ? CZ A ARG 164 ? ? NH2 A ARG 164 ? ? 117.13 120.30 -3.17 0.50 N 7 20 CA A CYS 179 ? ? CB A CYS 179 ? ? SG A CYS 179 ? ? 120.92 114.20 6.72 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 134 ? ? -163.44 -167.85 2 1 MET A 166 ? ? -48.48 102.47 3 1 GLU A 168 ? ? -162.74 -12.64 4 1 SER A 170 ? ? -162.52 11.24 5 1 PHE A 198 ? ? -65.01 -177.11 6 2 SER A 132 ? ? -59.39 -169.19 7 2 PRO A 165 ? ? -72.35 -168.99 8 2 MET A 166 ? ? -68.25 44.19 9 2 GLU A 168 ? ? -174.06 -16.93 10 2 GLN A 172 ? ? -92.28 -65.26 11 2 ASN A 181 ? ? -65.45 0.51 12 2 ILE A 182 ? ? -105.95 -70.27 13 2 PHE A 198 ? ? -68.04 -168.98 14 3 SER A 132 ? ? -69.30 -177.14 15 3 MET A 134 ? ? -160.01 50.68 16 3 SER A 135 ? ? 53.23 -150.60 17 3 PRO A 165 ? ? -67.87 -170.23 18 3 GLU A 168 ? ? -139.97 -99.07 19 3 SER A 170 ? ? 44.91 29.58 20 3 GLN A 172 ? ? -80.67 -101.25 21 4 SER A 132 ? ? -70.97 -163.07 22 4 MET A 134 ? ? -155.90 37.90 23 4 SER A 135 ? ? 49.09 -160.69 24 4 TYR A 145 ? ? -57.96 -72.39 25 4 HIS A 155 ? ? -65.61 0.55 26 4 GLU A 168 ? ? -159.70 -33.72 27 4 ASN A 171 ? ? 174.02 178.68 28 4 GLN A 172 ? ? -70.61 -79.70 29 5 TYR A 128 ? ? 42.80 -176.57 30 5 SER A 132 ? ? -54.53 171.83 31 5 MET A 134 ? ? -169.13 94.14 32 5 SER A 135 ? ? 35.46 -140.08 33 5 TYR A 145 ? ? -66.33 2.82 34 5 PRO A 165 ? ? -65.65 -178.20 35 5 MET A 166 ? ? -77.45 -147.81 36 5 GLU A 168 ? ? -144.99 -127.61 37 5 ASN A 171 ? ? -163.12 -144.37 38 5 GLU A 221 ? ? -134.58 -39.92 39 6 MET A 166 ? ? -62.58 90.60 40 6 GLU A 168 ? ? -153.36 -59.85 41 6 SER A 170 ? ? 47.37 24.13 42 6 ASN A 173 ? ? -88.12 -70.28 43 7 SER A 132 ? ? -63.09 -173.27 44 7 GLU A 168 ? ? -144.59 -37.98 45 7 PHE A 198 ? ? -69.03 -169.48 46 8 MET A 134 ? ? -168.48 59.20 47 8 SER A 135 ? ? 48.98 -146.66 48 8 MET A 166 ? ? -67.42 90.31 49 8 GLU A 168 ? ? -179.24 -70.00 50 8 SER A 170 ? ? -171.85 96.11 51 8 ASN A 171 ? ? -149.04 -148.95 52 8 GLN A 172 ? ? -83.19 -98.37 53 9 MET A 134 ? ? -165.03 33.63 54 9 SER A 135 ? ? 50.79 -149.26 55 9 GLU A 168 ? ? -157.76 -65.44 56 9 SER A 170 ? ? 46.20 10.04 57 10 MET A 134 ? ? -140.04 30.37 58 10 SER A 135 ? ? 47.99 -142.86 59 10 ASP A 167 ? ? 69.57 -4.25 60 10 GLU A 168 ? ? -129.84 -62.46 61 10 ASN A 171 ? ? -177.85 -171.99 62 10 GLN A 172 ? ? -97.25 -99.60 63 11 SER A 132 ? ? -132.20 -159.64 64 11 SER A 135 ? ? -68.61 -160.34 65 11 PHE A 141 ? ? -144.82 -4.91 66 11 TYR A 145 ? ? -61.83 1.96 67 11 GLU A 168 ? ? -147.93 -27.37 68 11 SER A 170 ? ? -160.38 94.98 69 12 TYR A 128 ? ? 47.78 -178.32 70 12 MET A 134 ? ? -152.04 55.40 71 12 SER A 135 ? ? 50.72 -155.12 72 12 MET A 166 ? ? -65.05 2.76 73 12 ASP A 167 ? ? -73.35 24.08 74 12 GLU A 168 ? ? -154.00 -149.69 75 12 SER A 170 ? ? 57.60 9.33 76 12 VAL A 176 ? ? -120.81 -54.70 77 13 ASP A 167 ? ? -64.72 0.38 78 13 SER A 170 ? ? 64.62 -22.06 79 13 LYS A 194 ? ? -64.96 0.00 80 13 PHE A 198 ? ? -59.87 -172.53 81 14 TYR A 145 ? ? -64.36 -75.79 82 14 GLU A 152 ? ? -58.10 -8.49 83 14 GLU A 168 ? ? -140.88 16.23 84 14 TYR A 169 ? ? -160.85 -69.84 85 14 SER A 170 ? ? 35.09 72.57 86 14 ASN A 171 ? ? -112.69 -160.00 87 14 GLN A 172 ? ? -121.55 -73.32 88 14 THR A 199 ? ? -115.01 -168.88 89 15 GLU A 168 ? ? -153.31 -29.19 90 15 SER A 170 ? ? -166.69 -6.08 91 15 GLN A 172 ? ? -68.23 -95.46 92 16 SER A 132 ? ? -62.84 -166.97 93 16 GLU A 168 ? ? -157.29 -80.16 94 17 TYR A 128 ? ? 51.52 141.61 95 17 ARG A 136 ? ? -39.94 114.32 96 17 TYR A 145 ? ? -65.07 2.23 97 17 MET A 166 ? ? -58.04 84.98 98 17 GLU A 168 ? ? -156.11 -99.97 99 17 SER A 170 ? ? 62.84 -1.41 100 18 TYR A 128 ? ? 41.70 -160.11 101 18 SER A 132 ? ? -72.18 -165.59 102 18 MET A 134 ? ? -152.03 50.37 103 18 SER A 135 ? ? 48.24 -159.89 104 18 PRO A 165 ? ? -65.66 -178.00 105 18 ASP A 167 ? ? 38.45 27.23 106 18 GLU A 168 ? ? 78.27 -15.49 107 18 ASN A 171 ? ? 47.10 -154.14 108 18 GLN A 172 ? ? -121.32 -101.02 109 18 ASN A 181 ? ? -59.88 -9.26 110 18 ILE A 182 ? ? -103.78 -63.75 111 18 GLN A 223 ? ? -69.18 4.06 112 19 MET A 134 ? ? -168.17 73.43 113 19 SER A 135 ? ? 49.74 -139.04 114 19 TYR A 163 ? ? -160.38 -157.61 115 19 MET A 166 ? ? -67.83 24.16 116 19 GLU A 168 ? ? -166.52 -27.15 117 19 ASN A 171 ? ? 63.73 174.18 118 19 ALA A 224 ? ? -92.74 -67.91 119 20 MET A 134 ? ? -167.41 41.58 120 20 SER A 135 ? ? 49.79 -149.20 121 20 PHE A 141 ? ? -141.90 -13.03 122 20 MET A 166 ? ? -59.87 90.77 123 20 ASP A 167 ? ? -143.66 -2.91 124 20 TYR A 169 ? ? 56.24 -66.76 125 20 SER A 170 ? ? 50.24 13.53 126 20 GLN A 172 ? ? -34.40 -83.25 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 169 ? ? 0.120 'SIDE CHAIN' 2 1 PHE A 198 ? ? 0.079 'SIDE CHAIN' 3 1 ARG A 228 ? ? 0.099 'SIDE CHAIN' 4 2 ARG A 136 ? ? 0.090 'SIDE CHAIN' 5 2 TYR A 150 ? ? 0.103 'SIDE CHAIN' 6 3 ARG A 136 ? ? 0.103 'SIDE CHAIN' 7 4 ARG A 148 ? ? 0.137 'SIDE CHAIN' 8 4 TYR A 150 ? ? 0.085 'SIDE CHAIN' 9 5 TYR A 128 ? ? 0.085 'SIDE CHAIN' 10 5 TYR A 150 ? ? 0.082 'SIDE CHAIN' 11 5 ARG A 208 ? ? 0.102 'SIDE CHAIN' 12 5 ARG A 220 ? ? 0.123 'SIDE CHAIN' 13 5 ARG A 228 ? ? 0.114 'SIDE CHAIN' 14 6 ARG A 136 ? ? 0.078 'SIDE CHAIN' 15 6 ARG A 151 ? ? 0.079 'SIDE CHAIN' 16 7 ARG A 148 ? ? 0.162 'SIDE CHAIN' 17 7 TYR A 150 ? ? 0.068 'SIDE CHAIN' 18 7 ARG A 151 ? ? 0.132 'SIDE CHAIN' 19 7 ARG A 208 ? ? 0.102 'SIDE CHAIN' 20 8 ARG A 148 ? ? 0.120 'SIDE CHAIN' 21 8 TYR A 150 ? ? 0.125 'SIDE CHAIN' 22 8 ARG A 228 ? ? 0.121 'SIDE CHAIN' 23 9 TYR A 149 ? ? 0.070 'SIDE CHAIN' 24 9 TYR A 150 ? ? 0.081 'SIDE CHAIN' 25 9 ARG A 151 ? ? 0.079 'SIDE CHAIN' 26 11 TYR A 150 ? ? 0.117 'SIDE CHAIN' 27 11 ARG A 151 ? ? 0.111 'SIDE CHAIN' 28 12 ARG A 148 ? ? 0.098 'SIDE CHAIN' 29 12 TYR A 162 ? ? 0.072 'SIDE CHAIN' 30 12 TYR A 169 ? ? 0.098 'SIDE CHAIN' 31 12 TYR A 218 ? ? 0.089 'SIDE CHAIN' 32 12 ARG A 228 ? ? 0.083 'SIDE CHAIN' 33 14 ARG A 148 ? ? 0.170 'SIDE CHAIN' 34 14 TYR A 150 ? ? 0.094 'SIDE CHAIN' 35 14 TYR A 169 ? ? 0.084 'SIDE CHAIN' 36 14 TYR A 225 ? ? 0.070 'SIDE CHAIN' 37 14 TYR A 226 ? ? 0.085 'SIDE CHAIN' 38 15 ARG A 136 ? ? 0.083 'SIDE CHAIN' 39 15 ARG A 148 ? ? 0.111 'SIDE CHAIN' 40 15 TYR A 150 ? ? 0.110 'SIDE CHAIN' 41 15 TYR A 169 ? ? 0.073 'SIDE CHAIN' 42 16 TYR A 162 ? ? 0.126 'SIDE CHAIN' 43 17 ARG A 148 ? ? 0.114 'SIDE CHAIN' 44 17 TYR A 162 ? ? 0.068 'SIDE CHAIN' 45 18 ARG A 148 ? ? 0.091 'SIDE CHAIN' 46 18 TYR A 150 ? ? 0.119 'SIDE CHAIN' 47 18 TYR A 162 ? ? 0.073 'SIDE CHAIN' 48 19 TYR A 150 ? ? 0.130 'SIDE CHAIN' 49 19 ARG A 151 ? ? 0.097 'SIDE CHAIN' 50 20 ARG A 148 ? ? 0.102 'SIDE CHAIN' 51 20 TYR A 150 ? ? 0.168 'SIDE CHAIN' 52 20 TYR A 169 ? ? 0.083 'SIDE CHAIN' 53 20 ARG A 228 ? ? 0.092 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1HJN _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWER TARGET FUNCTION' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_refine.entry_id 1HJN _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement OPALp ? R.KORADI,M.BILLETER,P.GUNTERT 1 'structure solution' DYANA ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 750 # _atom_sites.entry_id 1HJN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #