data_1HMY # _entry.id 1HMY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1HMY WWPDB D_1000173926 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HMY _pdbx_database_status.recvd_initial_deposition_date 1993-08-05 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site ? _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Cheng, X.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of the HhaI DNA methyltransferase complexed with S-adenosyl-L-methionine.' 'Cell(Cambridge,Mass.)' 74 299 307 1993 CELLB5 US 0092-8674 0998 ? 8343957 '10.1016/0092-8674(93)90421-L' 1 'Purification, Crystallization, and Preliminary X-Ray Diffraction Analysis of an M.HhaI-Adomet Complex' Biochemistry 31 8648 ? 1992 BICHAW US 0006-2960 0033 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Cheng, X.' 1 primary 'Kumar, S.' 2 primary 'Posfai, J.' 3 primary 'Pflugrath, J.W.' 4 primary 'Roberts, R.J.' 5 1 'Kumar, S.' 6 1 'Cheng, X.' 7 1 'Pflugrath, J.W.' 8 1 'Roberts, R.J.' 9 # _cell.entry_id 1HMY _cell.length_a 55.300 _cell.length_b 72.700 _cell.length_c 91.000 _cell.angle_alpha 90.00 _cell.angle_beta 102.50 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1HMY _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HaeIII METHYLTRANSFERASE' 37042.207 1 2.1.1.37 ? ? ? 2 non-polymer syn S-ADENOSYLMETHIONINE 398.437 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP QKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS SLNFKPY ; _entity_poly.pdbx_seq_one_letter_code_can ;MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP QKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS SLNFKPY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ILE n 1 3 GLU n 1 4 ILE n 1 5 LYS n 1 6 ASP n 1 7 LYS n 1 8 GLN n 1 9 LEU n 1 10 THR n 1 11 GLY n 1 12 LEU n 1 13 ARG n 1 14 PHE n 1 15 ILE n 1 16 ASP n 1 17 LEU n 1 18 PHE n 1 19 ALA n 1 20 GLY n 1 21 LEU n 1 22 GLY n 1 23 GLY n 1 24 PHE n 1 25 ARG n 1 26 LEU n 1 27 ALA n 1 28 LEU n 1 29 GLU n 1 30 SER n 1 31 CYS n 1 32 GLY n 1 33 ALA n 1 34 GLU n 1 35 CYS n 1 36 VAL n 1 37 TYR n 1 38 SER n 1 39 ASN n 1 40 GLU n 1 41 TRP n 1 42 ASP n 1 43 LYS n 1 44 TYR n 1 45 ALA n 1 46 GLN n 1 47 GLU n 1 48 VAL n 1 49 TYR n 1 50 GLU n 1 51 MET n 1 52 ASN n 1 53 PHE n 1 54 GLY n 1 55 GLU n 1 56 LYS n 1 57 PRO n 1 58 GLU n 1 59 GLY n 1 60 ASP n 1 61 ILE n 1 62 THR n 1 63 GLN n 1 64 VAL n 1 65 ASN n 1 66 GLU n 1 67 LYS n 1 68 THR n 1 69 ILE n 1 70 PRO n 1 71 ASP n 1 72 HIS n 1 73 ASP n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 ALA n 1 78 GLY n 1 79 PHE n 1 80 PRO n 1 81 CYS n 1 82 GLN n 1 83 ALA n 1 84 PHE n 1 85 SER n 1 86 ILE n 1 87 SER n 1 88 GLY n 1 89 LYS n 1 90 GLN n 1 91 LYS n 1 92 GLY n 1 93 PHE n 1 94 GLU n 1 95 ASP n 1 96 SER n 1 97 ARG n 1 98 GLY n 1 99 THR n 1 100 LEU n 1 101 PHE n 1 102 PHE n 1 103 ASP n 1 104 ILE n 1 105 ALA n 1 106 ARG n 1 107 ILE n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 LYS n 1 112 LYS n 1 113 PRO n 1 114 LYS n 1 115 VAL n 1 116 VAL n 1 117 PHE n 1 118 MET n 1 119 GLU n 1 120 ASN n 1 121 VAL n 1 122 LYS n 1 123 ASN n 1 124 PHE n 1 125 ALA n 1 126 SER n 1 127 HIS n 1 128 ASP n 1 129 ASN n 1 130 GLY n 1 131 ASN n 1 132 THR n 1 133 LEU n 1 134 GLU n 1 135 VAL n 1 136 VAL n 1 137 LYS n 1 138 ASN n 1 139 THR n 1 140 MET n 1 141 ASN n 1 142 GLU n 1 143 LEU n 1 144 ASP n 1 145 TYR n 1 146 SER n 1 147 PHE n 1 148 HIS n 1 149 ALA n 1 150 LYS n 1 151 VAL n 1 152 LEU n 1 153 ASN n 1 154 ALA n 1 155 LEU n 1 156 ASP n 1 157 TYR n 1 158 GLY n 1 159 ILE n 1 160 PRO n 1 161 GLN n 1 162 LYS n 1 163 ARG n 1 164 GLU n 1 165 ARG n 1 166 ILE n 1 167 TYR n 1 168 MET n 1 169 ILE n 1 170 CYS n 1 171 PHE n 1 172 ARG n 1 173 ASN n 1 174 ASP n 1 175 LEU n 1 176 ASN n 1 177 ILE n 1 178 GLN n 1 179 ASN n 1 180 PHE n 1 181 GLN n 1 182 PHE n 1 183 PRO n 1 184 LYS n 1 185 PRO n 1 186 PHE n 1 187 GLU n 1 188 LEU n 1 189 ASN n 1 190 THR n 1 191 PHE n 1 192 VAL n 1 193 LYS n 1 194 ASP n 1 195 LEU n 1 196 LEU n 1 197 LEU n 1 198 PRO n 1 199 ASP n 1 200 SER n 1 201 GLU n 1 202 VAL n 1 203 GLU n 1 204 HIS n 1 205 LEU n 1 206 VAL n 1 207 ILE n 1 208 ASP n 1 209 ARG n 1 210 LYS n 1 211 ASP n 1 212 LEU n 1 213 VAL n 1 214 MET n 1 215 THR n 1 216 ASN n 1 217 GLN n 1 218 GLU n 1 219 ILE n 1 220 GLU n 1 221 GLN n 1 222 THR n 1 223 THR n 1 224 PRO n 1 225 LYS n 1 226 THR n 1 227 VAL n 1 228 ARG n 1 229 LEU n 1 230 GLY n 1 231 ILE n 1 232 VAL n 1 233 GLY n 1 234 LYS n 1 235 GLY n 1 236 GLY n 1 237 GLN n 1 238 GLY n 1 239 GLU n 1 240 ARG n 1 241 ILE n 1 242 TYR n 1 243 SER n 1 244 THR n 1 245 ARG n 1 246 GLY n 1 247 ILE n 1 248 ALA n 1 249 ILE n 1 250 THR n 1 251 LEU n 1 252 SER n 1 253 ALA n 1 254 TYR n 1 255 GLY n 1 256 GLY n 1 257 GLY n 1 258 ILE n 1 259 PHE n 1 260 ALA n 1 261 LYS n 1 262 THR n 1 263 GLY n 1 264 GLY n 1 265 TYR n 1 266 LEU n 1 267 VAL n 1 268 ASN n 1 269 GLY n 1 270 LYS n 1 271 THR n 1 272 ARG n 1 273 LYS n 1 274 LEU n 1 275 HIS n 1 276 PRO n 1 277 ARG n 1 278 GLU n 1 279 CYS n 1 280 ALA n 1 281 ARG n 1 282 VAL n 1 283 MET n 1 284 GLY n 1 285 TYR n 1 286 PRO n 1 287 ASP n 1 288 SER n 1 289 TYR n 1 290 LYS n 1 291 VAL n 1 292 HIS n 1 293 PRO n 1 294 SER n 1 295 THR n 1 296 SER n 1 297 GLN n 1 298 ALA n 1 299 TYR n 1 300 LYS n 1 301 GLN n 1 302 PHE n 1 303 GLY n 1 304 ASN n 1 305 SER n 1 306 VAL n 1 307 VAL n 1 308 ILE n 1 309 ASN n 1 310 VAL n 1 311 LEU n 1 312 GLN n 1 313 TYR n 1 314 ILE n 1 315 ALA n 1 316 TYR n 1 317 ASN n 1 318 ILE n 1 319 GLY n 1 320 SER n 1 321 SER n 1 322 LEU n 1 323 ASN n 1 324 PHE n 1 325 LYS n 1 326 PRO n 1 327 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Haemophilus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus haemolyticus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 726 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MTH1_HAEHA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P05102 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPDHDILCAGFP CQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAKVLNALDYGIP QKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGER IYSTRGIAITLSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVLQYIAYNIGS SLNFKPY ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1HMY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 327 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05102 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 327 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 327 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAM non-polymer . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1HMY _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 4.82 _exptl_crystal.density_percent_sol 74.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _refine.entry_id 1HMY _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high 2.5 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.2000000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2000000 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details 'RESIDUES 85 - 91 ARE FLEXIBLE WITH HIGH TEMPERATURE FACTORS.' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_overall_phase_error ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2606 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2633 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low . # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.012 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.82 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 1HMY _struct.title 'CRYSTAL STRUCTURE OF THE HHAI DNA METHYLTRANSFERASE COMPLEXED WITH S-ADENOSYL-L-METHIONINE' _struct.pdbx_descriptor 'HHAI DNA (CYTOSINE-C5-)-METHYLTRANSFERASE (E.C.2.1.1.37) COMPLEX WITH S-ADENOSYL-L-METHIONINE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HMY _struct_keywords.pdbx_keywords 'TRANSFERASE(METHYLTRANSFERASE)' _struct_keywords.text 'TRANSFERASE(METHYLTRANSFERASE)' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A GLY A 23 ? CYS A 31 ? GLY A 23 CYS A 31 1 ? 9 HELX_P HELX_P2 B LYS A 43 ? ASN A 52 ? LYS A 43 ASN A 52 1 ? 10 HELX_P HELX_P3 C PHE A 101 ? GLU A 110 ? PHE A 101 GLU A 110 1 ? 10 HELX_P HELX_P4 D ASN A 131 ? LEU A 143 ? ASN A 131 LEU A 143 1 ? 13 HELX_P HELX_P5 E PRO A 276 ? MET A 283 ? PRO A 276 MET A 283 1 ? 8 HELX_P HELX_P6 F THR A 295 ? ASN A 304 ? THR A 295 ASN A 304 1 ? 10 HELX_P HELX_P7 G ILE A 308 ? ASN A 323 ? ILE A 308 ASN A 323 1 ? 16 HELX_P HELX_P8 B1 ILE A 61 ? GLN A 63 ? ILE A 61 GLN A 63 1 '3 RESIDUES' 3 HELX_P HELX_P9 B2 GLU A 66 ? THR A 68 ? GLU A 66 THR A 68 1 '3 RESIDUES' 3 HELX_P HELX_P10 B3 PHE A 93 ? ASP A 95 ? PHE A 93 ASP A 95 1 '3 RESIDUES' 3 HELX_P HELX_P11 C1 PHE A 124 ? SER A 126 ? PHE A 124 SER A 126 1 '3 RESIDUES' 3 HELX_P HELX_P12 D1 LEU A 155 ? TYR A 157 ? LEU A 155 TYR A 157 1 '3 RESIDUES' 3 HELX_P HELX_P13 D2 VAL A 192 ? LEU A 195 ? VAL A 192 LEU A 195 1 '4 RESIDUES' 4 HELX_P HELX_P14 D3 ASP A 199 ? VAL A 202 ? ASP A 199 VAL A 202 1 '4 RESIDUES' 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id ASP _struct_conn.ptnr1_label_seq_id 60 _struct_conn.ptnr1_label_atom_id OD1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id SAM _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CE _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id ASP _struct_conn.ptnr1_auth_seq_id 60 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id SAM _struct_conn.ptnr2_auth_seq_id 328 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.486 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 112 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 112 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 113 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 113 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.10 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details 1 ? 6 ? 2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense 1 1 2 ? parallel 1 2 3 ? parallel 1 3 4 ? parallel 1 4 5 ? anti-parallel 1 5 6 ? anti-parallel 2 1 2 ? anti-parallel 2 2 3 ? anti-parallel 2 3 4 ? anti-parallel 2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id 1 1 LEU A 12 ? LEU A 17 ? LEU A 12 LEU A 17 1 2 ALA A 33 ? GLU A 40 ? ALA A 33 GLU A 40 1 3 ALA A 83 ? SER A 87 ? ALA A 83 SER A 87 1 4 VAL A 115 ? ASN A 120 ? VAL A 115 ASN A 120 1 5 ARG A 163 ? PHE A 171 ? ARG A 163 PHE A 171 1 6 TYR A 145 ? ALA A 154 ? TYR A 145 ALA A 154 2 1 VAL A 206 ? LYS A 210 ? VAL A 206 LYS A 210 2 2 LYS A 270 ? LYS A 273 ? LYS A 270 LYS A 273 2 3 GLY A 264 ? VAL A 267 ? GLY A 264 VAL A 267 2 4 ARG A 240 ? THR A 244 ? ARG A 240 THR A 244 2 5 LYS A 225 ? VAL A 232 ? LYS A 225 VAL A 232 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE SAM A 328' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PHE A 18 ? PHE A 18 . ? 1_555 ? 2 AC1 10 GLU A 40 ? GLU A 40 . ? 1_555 ? 3 AC1 10 TRP A 41 ? TRP A 41 . ? 1_555 ? 4 AC1 10 ASP A 60 ? ASP A 60 . ? 1_555 ? 5 AC1 10 ILE A 61 ? ILE A 61 . ? 1_555 ? 6 AC1 10 THR A 62 ? THR A 62 . ? 1_555 ? 7 AC1 10 GLY A 78 ? GLY A 78 . ? 1_555 ? 8 AC1 10 PHE A 79 ? PHE A 79 . ? 1_555 ? 9 AC1 10 PRO A 80 ? PRO A 80 . ? 1_555 ? 10 AC1 10 LEU A 100 ? LEU A 100 . ? 1_555 ? # _database_PDB_matrix.entry_id 1HMY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HMY _atom_sites.fract_transf_matrix[1][1] 0.018083 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.004009 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013755 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011256 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_sites_footnote.id _atom_sites_footnote.text 1 'CIS PROLINE - PRO 113' 2 'RESIDUES 85 - 91 ARE FLEXIBLE WITH HIGH TEMPERATURE FACTORS.' # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 ASN 131 131 131 ASN ASN A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 ASN 141 141 141 ASN ASN A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 HIS 148 148 148 HIS HIS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 ARG 165 165 165 ARG ARG A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 TYR 167 167 167 TYR TYR A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 PHE 171 171 171 PHE PHE A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 GLN 181 181 181 GLN GLN A . n A 1 182 PHE 182 182 182 PHE PHE A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PRO 185 185 185 PRO PRO A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 PHE 191 191 191 PHE PHE A . n A 1 192 VAL 192 192 192 VAL VAL A . n A 1 193 LYS 193 193 193 LYS LYS A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 LEU 196 196 196 LEU LEU A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 PRO 198 198 198 PRO PRO A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 SER 200 200 200 SER SER A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 ILE 207 207 207 ILE ILE A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 ARG 209 209 209 ARG ARG A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ASP 211 211 211 ASP ASP A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 MET 214 214 214 MET MET A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 ASN 216 216 216 ASN ASN A . n A 1 217 GLN 217 217 217 GLN GLN A . n A 1 218 GLU 218 218 218 GLU GLU A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 GLN 221 221 221 GLN GLN A . n A 1 222 THR 222 222 222 THR THR A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 THR 226 226 226 THR THR A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 ARG 228 228 228 ARG ARG A . n A 1 229 LEU 229 229 229 LEU LEU A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 LYS 234 234 234 LYS LYS A . n A 1 235 GLY 235 235 235 GLY GLY A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 GLN 237 237 237 GLN GLN A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 GLU 239 239 239 GLU GLU A . n A 1 240 ARG 240 240 240 ARG ARG A . n A 1 241 ILE 241 241 241 ILE ILE A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 THR 244 244 244 THR THR A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 ILE 247 247 247 ILE ILE A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 THR 250 250 250 THR THR A . n A 1 251 LEU 251 251 251 LEU LEU A . n A 1 252 SER 252 252 252 SER SER A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 TYR 254 254 254 TYR TYR A . n A 1 255 GLY 255 255 255 GLY GLY A . n A 1 256 GLY 256 256 256 GLY GLY A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 ILE 258 258 258 ILE ILE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 LYS 261 261 261 LYS LYS A . n A 1 262 THR 262 262 262 THR THR A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 TYR 265 265 265 TYR TYR A . n A 1 266 LEU 266 266 266 LEU LEU A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 ASN 268 268 268 ASN ASN A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 THR 271 271 271 THR THR A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 LYS 273 273 273 LYS LYS A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 HIS 275 275 275 HIS HIS A . n A 1 276 PRO 276 276 276 PRO PRO A . n A 1 277 ARG 277 277 277 ARG ARG A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 CYS 279 279 279 CYS CYS A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 ARG 281 281 281 ARG ARG A . n A 1 282 VAL 282 282 282 VAL VAL A . n A 1 283 MET 283 283 283 MET MET A . n A 1 284 GLY 284 284 284 GLY GLY A . n A 1 285 TYR 285 285 285 TYR TYR A . n A 1 286 PRO 286 286 286 PRO PRO A . n A 1 287 ASP 287 287 287 ASP ASP A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 TYR 289 289 289 TYR TYR A . n A 1 290 LYS 290 290 290 LYS LYS A . n A 1 291 VAL 291 291 291 VAL VAL A . n A 1 292 HIS 292 292 292 HIS HIS A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 SER 294 294 294 SER SER A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 SER 296 296 296 SER SER A . n A 1 297 GLN 297 297 297 GLN GLN A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 TYR 299 299 299 TYR TYR A . n A 1 300 LYS 300 300 300 LYS LYS A . n A 1 301 GLN 301 301 301 GLN GLN A . n A 1 302 PHE 302 302 302 PHE PHE A . n A 1 303 GLY 303 303 303 GLY GLY A . n A 1 304 ASN 304 304 304 ASN ASN A . n A 1 305 SER 305 305 305 SER SER A . n A 1 306 VAL 306 306 306 VAL VAL A . n A 1 307 VAL 307 307 307 VAL VAL A . n A 1 308 ILE 308 308 308 ILE ILE A . n A 1 309 ASN 309 309 309 ASN ASN A . n A 1 310 VAL 310 310 310 VAL VAL A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 GLN 312 312 312 GLN GLN A . n A 1 313 TYR 313 313 313 TYR TYR A . n A 1 314 ILE 314 314 314 ILE ILE A . n A 1 315 ALA 315 315 315 ALA ALA A . n A 1 316 TYR 316 316 316 TYR TYR A . n A 1 317 ASN 317 317 317 ASN ASN A . n A 1 318 ILE 318 318 318 ILE ILE A . n A 1 319 GLY 319 319 319 GLY GLY A . n A 1 320 SER 320 320 320 SER SER A . n A 1 321 SER 321 321 321 SER SER A . n A 1 322 LEU 322 322 322 LEU LEU A . n A 1 323 ASN 323 323 323 ASN ASN A . n A 1 324 PHE 324 324 324 PHE PHE A . n A 1 325 LYS 325 325 325 LYS LYS A . n A 1 326 PRO 326 326 326 PRO PRO A . n A 1 327 TYR 327 327 327 TYR TYR A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id SAM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 328 _pdbx_nonpoly_scheme.auth_seq_num 328 _pdbx_nonpoly_scheme.pdb_mon_id SAM _pdbx_nonpoly_scheme.auth_mon_id SAM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1993-10-31 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-02-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Structure summary' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' . ? 1 X-PLOR refinement . ? 2 X-PLOR phasing . ? 3 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OD1 A ASN 129 ? ? 1_555 O A ARG 209 ? ? 2_556 1.96 2 1 ND2 A ASN 129 ? ? 1_555 O A ARG 209 ? ? 2_556 2.02 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A LYS 112 ? ? N A PRO 113 ? ? CD A PRO 113 ? ? 102.89 120.60 -17.71 2.20 Y 2 1 CA A LEU 152 ? ? CB A LEU 152 ? ? CG A LEU 152 ? ? 129.72 115.30 14.42 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 7 ? ? -66.96 58.52 2 1 GLN A 8 ? ? -47.44 1.65 3 1 ASP A 16 ? ? -103.56 76.18 4 1 GLU A 40 ? ? -177.66 117.70 5 1 LYS A 43 ? ? -38.55 -25.21 6 1 GLU A 58 ? ? -77.31 -169.14 7 1 ASP A 60 ? ? -12.95 100.64 8 1 LYS A 67 ? ? -64.10 2.79 9 1 GLN A 90 ? ? 54.46 -155.38 10 1 PHE A 93 ? ? -20.48 -52.18 11 1 LYS A 111 ? ? -160.82 108.00 12 1 LYS A 112 ? ? 46.43 -143.89 13 1 ASP A 144 ? ? 73.17 44.91 14 1 GLN A 161 ? ? -172.01 137.15 15 1 ARG A 163 ? ? -161.20 85.57 16 1 ASN A 176 ? ? 54.00 77.87 17 1 HIS A 204 ? ? -63.35 6.43 18 1 PRO A 224 ? ? -83.72 39.79 19 1 PHE A 259 ? ? -112.60 79.19 20 1 ASP A 287 ? ? -56.42 -3.65 21 1 ASN A 317 ? ? -57.20 -5.30 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id TYR _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 265 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.086 _pdbx_validate_planes.type 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name S-ADENOSYLMETHIONINE _pdbx_entity_nonpoly.comp_id SAM #