data_1HOY # _entry.id 1HOY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1HOY pdb_00001hoy 10.2210/pdb1hoy/pdb RCSB RCSB012489 ? ? WWPDB D_1000012489 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1HN7 _pdbx_database_related.details '1HN7 contains the minimized average structure' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1HOY _pdbx_database_status.recvd_initial_deposition_date 2000-12-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Scarselli, M.' 1 'Spiga, O.' 2 'Ciutti, A.' 3 'Bracci, L.' 4 'Lelli, B.' 5 'Lozzi, L.' 6 'Calamandrei, D.' 7 'Bernini, A.' 8 'Di Maro, D.' 9 'Niccolai, N.' 10 'Neri, P.' 11 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.' Biochemistry 41 1457 1463 2002 BICHAW US 0006-2960 0033 ? 11814338 10.1021/bi011012f 1 ;Peptide-protein interactions studied by surface plasmon and nuclear magnetic resonances ; 'FEBS Lett.' 511 33 35 2002 FEBLAL NE 0014-5793 0165 ? ? '10.1016/S0014-5793(01)03274-4' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Scarselli, M.' 1 ? primary 'Spiga, O.' 2 ? primary 'Ciutti, A.' 3 ? primary 'Bernini, A.' 4 ? primary 'Bracci, L.' 5 ? primary 'Lelli, B.' 6 ? primary 'Lozzi, L.' 7 ? primary 'Calamandrei, D.' 8 ? primary 'Di Maro, D.' 9 ? primary 'Klein, S.' 10 ? primary 'Niccolai, N.' 11 ? 1 'Spiga, O.' 12 ? 1 'Bernini, A.' 13 ? 1 'Scarselli, M.' 14 ? 1 'Ciutti, A.' 15 ? 1 'Bracci, L.' 16 ? 1 'Lozzi, L.' 17 ? 1 'Lelli, B.' 18 ? 1 'Di Maro, D.' 19 ? 1 'Calamandrei, D.' 20 ? 1 'Niccolai, N.' 21 ? # _cell.entry_id 1HOY _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1HOY _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'LONG NEUROTOXIN 1' 8005.281 1 ? ? ? ? 2 polymer syn 'MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR' 1843.945 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ALPHA-BUNGAROTOXIN # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG A ? 2 'polypeptide(L)' no no HRYYESSLEPWYPD HRYYESSLEPWYPD B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 CYS n 1 4 HIS n 1 5 THR n 1 6 THR n 1 7 ALA n 1 8 THR n 1 9 SER n 1 10 PRO n 1 11 ILE n 1 12 SER n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 CYS n 1 17 PRO n 1 18 PRO n 1 19 GLY n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 CYS n 1 24 TYR n 1 25 ARG n 1 26 LYS n 1 27 MET n 1 28 TRP n 1 29 CYS n 1 30 ASP n 1 31 ALA n 1 32 PHE n 1 33 CYS n 1 34 SER n 1 35 SER n 1 36 ARG n 1 37 GLY n 1 38 LYS n 1 39 VAL n 1 40 VAL n 1 41 GLU n 1 42 LEU n 1 43 GLY n 1 44 CYS n 1 45 ALA n 1 46 ALA n 1 47 THR n 1 48 CYS n 1 49 PRO n 1 50 SER n 1 51 LYS n 1 52 LYS n 1 53 PRO n 1 54 TYR n 1 55 GLU n 1 56 GLU n 1 57 VAL n 1 58 THR n 1 59 CYS n 1 60 CYS n 1 61 SER n 1 62 THR n 1 63 ASP n 1 64 LYS n 1 65 CYS n 1 66 ASN n 1 67 PRO n 1 68 HIS n 1 69 PRO n 1 70 LYS n 1 71 GLN n 1 72 ARG n 1 73 PRO n 1 74 GLY n 2 1 HIS n 2 2 ARG n 2 3 TYR n 2 4 TYR n 2 5 GLU n 2 6 SER n 2 7 SER n 2 8 LEU n 2 9 GLU n 2 10 PRO n 2 11 TRP n 2 12 TYR n 2 13 PRO n 2 14 ASP n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'many-banded krait' _entity_src_nat.pdbx_organism_scientific 'Bungarus multicinctus' _entity_src_nat.pdbx_ncbi_taxonomy_id 8616 _entity_src_nat.genus Bungarus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion VENOM _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This peptide was chemically synthesized.' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP NXL1A_BUNMU 1 IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG 1 P60615 ? 2 PDB 1HOY 2 ? ? 1HOY ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1HOY A 1 ? 74 ? P60615 1 ? 74 ? 1 74 2 2 1HOY B 1 ? 14 ? 1HOY 1 ? 14 ? 1 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.67 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5mM a-bungarotoxin;0.5mM peptide; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1HOY _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'the structures are based on a total of 1607 NOE-derived distance constraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1HOY _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1HOY _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1HOY _pdbx_nmr_representative.conformer_id 20 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.1 collection Bruker 1 XwinNMR 2.1 processing Bruker 2 NMRView 4.1.1 'data analysis' 'Merck et al.' 3 DYANA 1.5 'structure solution' 'Gunter,P. et al' 4 Amber 4.1 refinement 'Pearlman,D.A. et al' 5 # _exptl.entry_id 1HOY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1HOY _struct.title 'NMR STRUCTURE OF THE COMPLEX BETWEEN A-BUNGAROTOXIN AND A MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1HOY _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'ALPHA-BUNGAROTOXIN, PROTEIN-PEPTIDE COMPLEX, AcChoR mimotope, TOXIN, BETA-STRANDS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 23 SG ? ? A CYS 3 A CYS 23 1_555 ? ? ? ? ? ? ? 2.592 ? ? disulf2 disulf ? ? A CYS 48 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 48 A CYS 59 1_555 ? ? ? ? ? ? ? 2.975 ? ? disulf3 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 65 SG ? ? A CYS 60 A CYS 65 1_555 ? ? ? ? ? ? ? 2.411 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 3 ? HIS A 4 ? CYS A 3 HIS A 4 A 2 ALA A 13 ? VAL A 14 ? ALA A 13 VAL A 14 B 1 LEU A 22 ? LYS A 26 ? LEU A 22 LYS A 26 B 2 GLU A 41 ? ALA A 45 ? GLU A 41 ALA A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 3 ? O CYS A 3 N VAL A 14 ? N VAL A 14 B 1 2 O LYS A 26 ? O LYS A 26 N GLU A 41 ? N GLU A 41 # _database_PDB_matrix.entry_id 1HOY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1HOY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n B 2 1 HIS 1 1 1 HIS HIS B . n B 2 2 ARG 2 2 2 ARG ARG B . n B 2 3 TYR 3 3 3 TYR TYR B . n B 2 4 TYR 4 4 4 TYR TYR B . n B 2 5 GLU 5 5 5 GLU GLU B . n B 2 6 SER 6 6 6 SER SER B . n B 2 7 SER 7 7 7 SER SER B . n B 2 8 LEU 8 8 8 LEU LEU B . n B 2 9 GLU 9 9 9 GLU GLU B . n B 2 10 PRO 10 10 10 PRO PRO B . n B 2 11 TRP 11 11 11 TRP TRP B . n B 2 12 TYR 12 12 12 TYR TYR B . n B 2 13 PRO 13 13 13 PRO PRO B . n B 2 14 ASP 14 14 14 ASP ASP B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2000-12-27 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.14 2 1 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.17 3 1 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.22 4 1 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 5 1 O B GLU 9 ? ? CD B PRO 13 ? ? 1.35 6 1 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.41 7 1 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.45 8 1 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.52 9 1 O B GLU 9 ? ? CG B PRO 13 ? ? 1.56 10 1 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 11 1 OD1 A ASP 30 ? ? HE B ARG 2 ? ? 1.59 12 1 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 13 1 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 14 2 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.14 15 2 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.16 16 2 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 17 2 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.33 18 2 O B GLU 9 ? ? CD B PRO 13 ? ? 1.36 19 2 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.42 20 2 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.46 21 2 O B GLU 9 ? ? CG B PRO 13 ? ? 1.51 22 2 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.56 23 2 OD1 A ASP 30 ? ? HE B ARG 2 ? ? 1.57 24 2 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 25 2 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 26 2 H A CYS 23 ? ? O A CYS 60 ? ? 1.60 27 2 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 28 2 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 29 3 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.14 30 3 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 31 3 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.34 32 3 O B GLU 9 ? ? CD B PRO 13 ? ? 1.36 33 3 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.40 34 3 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.47 35 3 HG A SER 50 ? ? O A VAL 57 ? ? 1.52 36 3 O B GLU 9 ? ? CG B PRO 13 ? ? 1.52 37 3 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.55 38 3 OD1 A ASP 30 ? ? HE B ARG 2 ? ? 1.56 39 3 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 40 3 H A CYS 23 ? ? O A CYS 60 ? ? 1.59 41 3 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 42 3 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 43 4 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 44 4 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.16 45 4 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.28 46 4 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.34 47 4 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.35 48 4 O B GLU 9 ? ? CD B PRO 13 ? ? 1.38 49 4 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.42 50 4 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.47 51 4 OD2 A ASP 30 ? ? H A ALA 31 ? ? 1.52 52 4 O B GLU 9 ? ? CG B PRO 13 ? ? 1.54 53 4 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.56 54 4 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.58 55 4 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.60 56 4 H A CYS 23 ? ? O A CYS 60 ? ? 1.60 57 4 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 58 4 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 59 4 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.19 60 5 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.14 61 5 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.26 62 5 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.27 63 5 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.35 64 5 O B GLU 9 ? ? CD B PRO 13 ? ? 1.36 65 5 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.41 66 5 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.46 67 5 O B GLU 9 ? ? CG B PRO 13 ? ? 1.50 68 5 HG A SER 50 ? ? O A VAL 57 ? ? 1.54 69 5 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.57 70 5 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.57 71 5 H A CYS 23 ? ? O A CYS 60 ? ? 1.59 72 5 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 73 5 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 74 5 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.19 75 6 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 76 6 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.15 77 6 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 78 6 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.27 79 6 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.35 80 6 O B GLU 9 ? ? CD B PRO 13 ? ? 1.39 81 6 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.43 82 6 O A LYS 70 ? ? H A ARG 72 ? ? 1.44 83 6 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.49 84 6 O B GLU 9 ? ? CG B PRO 13 ? ? 1.53 85 6 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.57 86 6 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 87 6 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 88 6 H A CYS 23 ? ? O A CYS 60 ? ? 1.59 89 6 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 90 6 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 91 6 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 92 7 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.16 93 7 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.17 94 7 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.26 95 7 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.32 96 7 HB3 A LYS 70 ? ? H B SER 7 ? ? 1.32 97 7 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.38 98 7 O B GLU 9 ? ? CD B PRO 13 ? ? 1.41 99 7 O A LYS 70 ? ? H A ARG 72 ? ? 1.48 100 7 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.50 101 7 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.57 102 7 O B GLU 9 ? ? CG B PRO 13 ? ? 1.57 103 7 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.58 104 7 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 105 7 O A TYR 54 ? ? N A GLU 56 ? ? 2.06 106 8 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.17 107 8 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.17 108 8 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 109 8 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.39 110 8 O B GLU 9 ? ? CD B PRO 13 ? ? 1.47 111 8 O A LYS 70 ? ? H A ARG 72 ? ? 1.48 112 8 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.48 113 8 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 114 8 H A CYS 23 ? ? O A CYS 60 ? ? 1.60 115 8 O B GLU 9 ? ? CG B PRO 13 ? ? 1.61 116 8 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 117 8 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 118 8 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.19 119 9 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.13 120 9 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 121 9 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.25 122 9 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 123 9 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.35 124 9 O B GLU 9 ? ? CD B PRO 13 ? ? 1.35 125 9 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.42 126 9 O A LYS 70 ? ? H A ARG 72 ? ? 1.43 127 9 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.48 128 9 O B GLU 9 ? ? CG B PRO 13 ? ? 1.49 129 9 OD2 A ASP 30 ? ? H A ALA 31 ? ? 1.52 130 9 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.53 131 9 HG A SER 50 ? ? O A VAL 57 ? ? 1.55 132 9 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.57 133 9 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 134 9 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 135 9 O A TYR 54 ? ? N A GLU 56 ? ? 2.06 136 9 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 137 10 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 138 10 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.21 139 10 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.22 140 10 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.24 141 10 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.26 142 10 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.48 143 10 HG A SER 50 ? ? O A VAL 57 ? ? 1.48 144 10 O B GLU 9 ? ? CD B PRO 13 ? ? 1.49 145 10 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.51 146 10 OD1 A ASP 30 ? ? HE B ARG 2 ? ? 1.54 147 10 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.58 148 10 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 149 10 O B GLU 9 ? ? CG B PRO 13 ? ? 1.60 150 10 O A HIS 68 ? ? CD A LYS 70 ? ? 2.01 151 10 O A TYR 54 ? ? N A GLU 56 ? ? 2.06 152 11 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.15 153 11 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.17 154 11 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 155 11 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.35 156 11 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.42 157 11 O B GLU 9 ? ? CD B PRO 13 ? ? 1.44 158 11 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.52 159 11 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.57 160 11 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 161 11 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.59 162 11 O B GLU 9 ? ? CG B PRO 13 ? ? 1.61 163 11 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 164 11 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 165 11 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 166 12 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.15 167 12 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.16 168 12 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 169 12 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.35 170 12 O B GLU 9 ? ? CD B PRO 13 ? ? 1.37 171 12 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.42 172 12 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.49 173 12 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.51 174 12 O A LYS 70 ? ? H A ARG 72 ? ? 1.55 175 12 O B GLU 9 ? ? CG B PRO 13 ? ? 1.56 176 12 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 177 12 H A CYS 23 ? ? O A CYS 60 ? ? 1.59 178 12 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.60 179 12 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 180 12 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 181 12 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 182 13 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.15 183 13 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 184 13 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 185 13 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.34 186 13 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.41 187 13 O B GLU 9 ? ? CD B PRO 13 ? ? 1.44 188 13 O A LYS 70 ? ? H A ARG 72 ? ? 1.47 189 13 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.51 190 13 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 191 13 O B GLU 9 ? ? CG B PRO 13 ? ? 1.59 192 13 H B HIS 1 ? ? OD1 B ASP 14 ? ? 1.59 193 13 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.60 194 13 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 195 13 O A TYR 54 ? ? N A GLU 56 ? ? 2.06 196 13 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 197 14 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.17 198 14 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.20 199 14 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.23 200 14 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.31 201 14 O B GLU 9 ? ? CD B PRO 13 ? ? 1.39 202 14 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.41 203 14 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.49 204 14 O B GLU 9 ? ? CG B PRO 13 ? ? 1.54 205 14 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.56 206 14 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.56 207 14 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 208 14 O A HIS 68 ? ? CD A LYS 70 ? ? 2.00 209 14 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 210 14 O A THR 6 ? ? CZ B TYR 3 ? ? 2.19 211 15 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.17 212 15 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.18 213 15 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.22 214 15 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 215 15 H A ASN 66 ? ? HD3 A PRO 67 ? ? 1.34 216 15 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.43 217 15 O B GLU 9 ? ? CD B PRO 13 ? ? 1.48 218 15 OD2 A ASP 30 ? ? H A ALA 31 ? ? 1.51 219 15 HG A SER 50 ? ? O A VAL 57 ? ? 1.52 220 15 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.54 221 15 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.57 222 15 H A CYS 23 ? ? O A CYS 60 ? ? 1.58 223 15 O B GLU 9 ? ? CG B PRO 13 ? ? 1.63 224 15 O A HIS 68 ? ? CD A LYS 70 ? ? 1.99 225 15 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 226 15 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 227 16 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.14 228 16 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.17 229 16 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.24 230 16 HB3 A LYS 70 ? ? H B SER 7 ? ? 1.30 231 16 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.30 232 16 O B GLU 9 ? ? CD B PRO 13 ? ? 1.33 233 16 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.40 234 16 O B GLU 9 ? ? CG B PRO 13 ? ? 1.47 235 16 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.50 236 16 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.50 237 16 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 238 16 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 239 16 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 240 16 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 241 17 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.16 242 17 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.16 243 17 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 244 17 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.39 245 17 O A LYS 70 ? ? H A ARG 72 ? ? 1.45 246 17 O B GLU 9 ? ? CD B PRO 13 ? ? 1.46 247 17 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.48 248 17 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.58 249 17 O B GLU 9 ? ? CG B PRO 13 ? ? 1.60 250 17 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 251 17 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 252 18 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 253 18 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.17 254 18 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.24 255 18 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.24 256 18 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.26 257 18 O B GLU 9 ? ? CD B PRO 13 ? ? 1.38 258 18 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.44 259 18 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.46 260 18 OD2 A ASP 30 ? ? H A ALA 31 ? ? 1.52 261 18 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.52 262 18 O B GLU 9 ? ? CG B PRO 13 ? ? 1.54 263 18 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.59 264 18 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.59 265 18 H A CYS 23 ? ? O A CYS 60 ? ? 1.60 266 18 O A HIS 68 ? ? CD A LYS 70 ? ? 2.01 267 18 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 268 19 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.16 269 19 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.17 270 19 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.27 271 19 O B GLU 9 ? ? CD B PRO 13 ? ? 1.42 272 19 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.43 273 19 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.49 274 19 HG A SER 50 ? ? O A VAL 57 ? ? 1.51 275 19 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.58 276 19 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.59 277 19 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.59 278 19 O B GLU 9 ? ? CG B PRO 13 ? ? 1.60 279 19 O A HIS 68 ? ? CD A LYS 70 ? ? 1.98 280 19 O A TYR 54 ? ? N A GLU 56 ? ? 2.05 281 19 O A THR 6 ? ? CE1 B TYR 3 ? ? 2.18 282 20 HB2 A CYS 16 ? ? HG A CYS 44 ? ? 1.15 283 20 HD11 A ILE 11 ? ? HE2 A HIS 68 ? ? 1.24 284 20 HG1 A THR 6 ? ? H A LEU 42 ? ? 1.26 285 20 HZ3 A LYS 70 ? ? HE21 A GLN 71 ? ? 1.28 286 20 HG2 A PRO 49 ? ? HG11 A VAL 57 ? ? 1.31 287 20 O B GLU 9 ? ? CD B PRO 13 ? ? 1.37 288 20 O B GLU 9 ? ? HD2 B PRO 13 ? ? 1.43 289 20 HG A SER 50 ? ? O A VAL 57 ? ? 1.43 290 20 O A HIS 68 ? ? HD3 A LYS 70 ? ? 1.47 291 20 O A HIS 68 ? ? HZ1 A LYS 70 ? ? 1.50 292 20 OD2 A ASP 30 ? ? H A ALA 31 ? ? 1.52 293 20 O B GLU 9 ? ? CG B PRO 13 ? ? 1.54 294 20 O A TRP 28 ? ? HB3 A LYS 38 ? ? 1.57 295 20 O B GLU 9 ? ? HD3 B PRO 13 ? ? 1.60 296 20 O A HIS 68 ? ? CD A LYS 70 ? ? 2.01 297 20 O A TYR 54 ? ? N A GLU 56 ? ? 2.04 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 8 ? ? -74.89 -104.24 2 1 SER A 9 ? ? -62.81 -161.64 3 1 ILE A 11 ? ? 166.23 103.31 4 1 LEU A 22 ? ? -174.66 -170.83 5 1 TRP A 28 ? ? -166.16 -101.67 6 1 CYS A 29 ? ? -175.69 119.28 7 1 ASP A 30 ? ? -48.21 178.04 8 1 CYS A 33 ? ? 37.50 59.14 9 1 SER A 34 ? ? -59.51 176.53 10 1 VAL A 39 ? ? -104.68 -162.20 11 1 VAL A 40 ? ? -153.50 75.95 12 1 LEU A 42 ? ? -66.68 -179.34 13 1 CYS A 48 ? ? -34.84 97.66 14 1 SER A 50 ? ? -25.11 139.36 15 1 LYS A 51 ? ? -93.85 -114.93 16 1 LYS A 52 ? ? -155.93 -52.59 17 1 PRO A 53 ? ? -75.00 -107.21 18 1 GLU A 55 ? ? -36.63 72.91 19 1 THR A 58 ? ? -127.57 -145.61 20 1 CYS A 60 ? ? -179.95 114.91 21 1 THR A 62 ? ? -49.30 165.13 22 1 HIS A 68 ? ? -37.83 158.04 23 1 LYS A 70 ? ? -160.99 -40.03 24 1 GLN A 71 ? ? -57.05 78.21 25 1 TYR B 4 ? ? -58.80 -165.47 26 1 SER B 6 ? ? -148.68 -4.61 27 1 PRO B 10 ? ? -74.92 24.88 28 2 THR A 8 ? ? -74.97 -103.83 29 2 SER A 9 ? ? -63.55 -161.26 30 2 ILE A 11 ? ? 165.98 103.33 31 2 LEU A 22 ? ? -173.65 -171.37 32 2 TRP A 28 ? ? -167.27 -101.40 33 2 CYS A 29 ? ? -176.41 118.11 34 2 ASP A 30 ? ? -47.07 177.73 35 2 CYS A 33 ? ? 37.10 62.43 36 2 VAL A 39 ? ? -103.42 -161.73 37 2 VAL A 40 ? ? -153.93 76.35 38 2 LEU A 42 ? ? -66.54 -178.34 39 2 CYS A 48 ? ? -33.03 97.68 40 2 SER A 50 ? ? -24.86 139.44 41 2 LYS A 51 ? ? -93.91 -114.62 42 2 LYS A 52 ? ? -156.29 -52.35 43 2 PRO A 53 ? ? -74.94 -106.38 44 2 GLU A 55 ? ? -36.14 72.49 45 2 THR A 58 ? ? -127.40 -144.28 46 2 CYS A 60 ? ? 179.76 114.85 47 2 THR A 62 ? ? -49.64 166.20 48 2 HIS A 68 ? ? -38.32 158.11 49 2 LYS A 70 ? ? -160.87 -41.05 50 2 GLN A 71 ? ? -54.56 79.94 51 2 TYR B 4 ? ? -59.39 -166.10 52 2 SER B 6 ? ? -148.72 -3.16 53 2 PRO B 10 ? ? -74.95 24.07 54 3 THR A 8 ? ? -75.00 -104.16 55 3 SER A 9 ? ? -63.14 -161.46 56 3 ILE A 11 ? ? 166.88 103.82 57 3 LEU A 22 ? ? -172.06 -171.35 58 3 TRP A 28 ? ? -166.47 -101.28 59 3 CYS A 29 ? ? -174.46 121.79 60 3 ASP A 30 ? ? -49.61 178.14 61 3 CYS A 33 ? ? 35.51 60.58 62 3 ARG A 36 ? ? -67.65 1.49 63 3 VAL A 39 ? ? -106.45 -162.58 64 3 VAL A 40 ? ? -153.22 76.18 65 3 LEU A 42 ? ? -66.89 -176.81 66 3 CYS A 48 ? ? -33.54 97.45 67 3 SER A 50 ? ? -24.82 139.61 68 3 LYS A 51 ? ? -94.41 -114.32 69 3 LYS A 52 ? ? -156.61 -52.44 70 3 PRO A 53 ? ? -74.90 -107.16 71 3 GLU A 55 ? ? -36.52 72.28 72 3 THR A 58 ? ? -127.80 -146.22 73 3 CYS A 60 ? ? 179.52 115.45 74 3 THR A 62 ? ? -48.83 165.53 75 3 HIS A 68 ? ? -38.24 157.78 76 3 LYS A 70 ? ? -160.44 -40.86 77 3 GLN A 71 ? ? -54.91 79.94 78 3 TYR B 4 ? ? -56.37 -165.37 79 3 SER B 6 ? ? -145.18 -0.35 80 3 PRO B 10 ? ? -75.02 25.12 81 4 THR A 8 ? ? -74.43 -103.97 82 4 SER A 9 ? ? -63.81 -161.20 83 4 ILE A 11 ? ? 166.02 103.04 84 4 LEU A 22 ? ? -173.30 -171.36 85 4 TRP A 28 ? ? -167.78 -100.89 86 4 CYS A 29 ? ? -178.26 117.89 87 4 ASP A 30 ? ? -48.66 175.37 88 4 CYS A 33 ? ? 37.71 60.37 89 4 SER A 34 ? ? -59.86 174.36 90 4 VAL A 39 ? ? -103.11 -162.67 91 4 VAL A 40 ? ? -153.51 76.70 92 4 LEU A 42 ? ? -65.86 -177.85 93 4 CYS A 48 ? ? -33.37 97.65 94 4 SER A 50 ? ? -24.10 139.10 95 4 LYS A 51 ? ? -93.64 -114.77 96 4 LYS A 52 ? ? -156.03 -52.65 97 4 PRO A 53 ? ? -74.85 -106.89 98 4 GLU A 55 ? ? -36.54 72.49 99 4 THR A 58 ? ? -127.78 -145.13 100 4 CYS A 60 ? ? 179.60 114.98 101 4 THR A 62 ? ? -49.49 165.74 102 4 HIS A 68 ? ? -38.20 158.13 103 4 LYS A 70 ? ? -161.20 -41.11 104 4 GLN A 71 ? ? -55.56 80.02 105 4 TYR B 4 ? ? -59.88 -166.06 106 4 SER B 6 ? ? -146.40 -5.51 107 4 PRO B 10 ? ? -74.99 26.00 108 5 THR A 8 ? ? -74.86 -104.20 109 5 SER A 9 ? ? -63.07 -161.43 110 5 ILE A 11 ? ? 166.49 104.45 111 5 LEU A 22 ? ? -172.23 -171.55 112 5 TRP A 28 ? ? -169.58 -101.85 113 5 CYS A 29 ? ? -174.36 121.14 114 5 ASP A 30 ? ? -49.42 177.72 115 5 CYS A 33 ? ? 35.45 60.91 116 5 ARG A 36 ? ? -68.25 1.53 117 5 VAL A 39 ? ? -105.05 -163.85 118 5 VAL A 40 ? ? -152.45 77.87 119 5 LEU A 42 ? ? -67.25 -176.70 120 5 CYS A 48 ? ? -33.91 97.11 121 5 SER A 50 ? ? -25.30 139.61 122 5 LYS A 51 ? ? -94.19 -114.62 123 5 LYS A 52 ? ? -156.17 -52.59 124 5 PRO A 53 ? ? -75.00 -107.11 125 5 GLU A 55 ? ? -36.91 72.70 126 5 THR A 58 ? ? -127.74 -146.20 127 5 CYS A 60 ? ? 178.82 115.15 128 5 THR A 62 ? ? -48.44 164.01 129 5 HIS A 68 ? ? -38.37 158.27 130 5 LYS A 70 ? ? -160.50 -40.73 131 5 GLN A 71 ? ? -56.47 78.21 132 5 TYR B 4 ? ? -56.15 -165.58 133 5 SER B 6 ? ? -142.20 -0.24 134 5 PRO B 10 ? ? -74.94 24.78 135 6 THR A 8 ? ? -74.14 -103.68 136 6 SER A 9 ? ? -64.03 -161.30 137 6 ILE A 11 ? ? 166.06 102.58 138 6 LEU A 22 ? ? -173.12 -170.80 139 6 TRP A 28 ? ? -168.50 -101.17 140 6 CYS A 29 ? ? -175.57 120.57 141 6 ASP A 30 ? ? -49.40 177.96 142 6 CYS A 33 ? ? 35.97 60.29 143 6 VAL A 39 ? ? -104.57 -163.78 144 6 VAL A 40 ? ? -152.53 77.31 145 6 LEU A 42 ? ? -67.72 -179.00 146 6 CYS A 48 ? ? -33.81 97.51 147 6 SER A 50 ? ? -25.23 139.02 148 6 LYS A 51 ? ? -93.36 -114.54 149 6 LYS A 52 ? ? -156.63 -52.29 150 6 PRO A 53 ? ? -74.95 -106.54 151 6 GLU A 55 ? ? -36.26 73.20 152 6 THR A 58 ? ? -127.93 -146.25 153 6 CYS A 60 ? ? 179.90 115.87 154 6 THR A 62 ? ? -48.35 165.84 155 6 HIS A 68 ? ? -38.10 157.84 156 6 LYS A 70 ? ? -162.22 -37.23 157 6 GLN A 71 ? ? -60.39 61.28 158 6 PRO A 73 ? ? -74.96 -163.04 159 6 TYR B 4 ? ? -57.45 -165.64 160 6 SER B 6 ? ? -144.60 -3.51 161 6 PRO B 10 ? ? -74.97 27.83 162 7 THR A 8 ? ? -73.70 -103.85 163 7 SER A 9 ? ? -63.74 -161.54 164 7 ILE A 11 ? ? 166.40 102.90 165 7 LEU A 22 ? ? -173.56 -171.36 166 7 CYS A 23 ? ? -103.31 -169.93 167 7 TRP A 28 ? ? -167.66 -101.75 168 7 CYS A 29 ? ? -175.28 119.43 169 7 ASP A 30 ? ? -48.63 177.37 170 7 CYS A 33 ? ? 36.62 60.34 171 7 VAL A 39 ? ? -104.55 -162.23 172 7 VAL A 40 ? ? -153.78 77.08 173 7 LEU A 42 ? ? -66.95 -178.80 174 7 CYS A 48 ? ? -34.11 97.53 175 7 SER A 50 ? ? -25.26 139.41 176 7 LYS A 51 ? ? -93.76 -114.26 177 7 LYS A 52 ? ? -156.97 -52.32 178 7 PRO A 53 ? ? -74.96 -106.61 179 7 GLU A 55 ? ? -37.12 73.40 180 7 THR A 58 ? ? -127.58 -144.99 181 7 CYS A 60 ? ? 179.82 114.80 182 7 THR A 62 ? ? -49.67 165.25 183 7 HIS A 68 ? ? -38.74 158.28 184 7 LYS A 70 ? ? -159.36 -39.99 185 7 GLN A 71 ? ? -62.22 61.35 186 7 TYR B 4 ? ? -58.06 -166.19 187 7 SER B 6 ? ? -154.21 10.49 188 7 SER B 7 ? ? 175.57 161.07 189 7 PRO B 10 ? ? -75.05 32.94 190 7 TRP B 11 ? ? -132.40 -36.02 191 8 THR A 8 ? ? -74.54 -103.65 192 8 SER A 9 ? ? -63.96 -161.40 193 8 ILE A 11 ? ? 166.04 103.04 194 8 LEU A 22 ? ? -173.90 -171.12 195 8 TRP A 28 ? ? -167.84 -101.22 196 8 CYS A 29 ? ? -175.51 120.13 197 8 ASP A 30 ? ? -49.05 177.89 198 8 CYS A 33 ? ? 36.17 61.11 199 8 VAL A 39 ? ? -104.44 -163.06 200 8 VAL A 40 ? ? -153.05 77.38 201 8 LEU A 42 ? ? -66.71 -177.37 202 8 CYS A 48 ? ? -34.10 97.69 203 8 SER A 50 ? ? -25.04 139.56 204 8 LYS A 51 ? ? -94.05 -114.96 205 8 LYS A 52 ? ? -155.91 -52.66 206 8 PRO A 53 ? ? -74.87 -106.72 207 8 GLU A 55 ? ? -36.20 72.76 208 8 THR A 58 ? ? -127.44 -146.21 209 8 CYS A 60 ? ? 179.99 115.29 210 8 THR A 62 ? ? -49.05 165.41 211 8 HIS A 68 ? ? -38.49 158.16 212 8 LYS A 70 ? ? -160.20 -38.86 213 8 GLN A 71 ? ? -62.50 61.18 214 8 ARG B 2 ? ? 178.23 165.72 215 8 TYR B 4 ? ? -58.40 -164.84 216 8 SER B 6 ? ? -153.40 4.30 217 8 PRO B 10 ? ? -75.05 37.50 218 8 TRP B 11 ? ? -136.72 -36.67 219 9 THR A 8 ? ? -74.93 -104.16 220 9 SER A 9 ? ? -63.20 -161.30 221 9 ILE A 11 ? ? 165.90 102.81 222 9 LEU A 22 ? ? -173.09 -170.77 223 9 TRP A 28 ? ? -166.43 -101.72 224 9 CYS A 29 ? ? -176.61 117.64 225 9 ASP A 30 ? ? -47.92 176.01 226 9 CYS A 33 ? ? 36.93 59.87 227 9 SER A 34 ? ? -58.21 175.30 228 9 VAL A 39 ? ? -103.98 -162.40 229 9 VAL A 40 ? ? -153.59 75.86 230 9 LEU A 42 ? ? -66.65 -178.80 231 9 CYS A 48 ? ? -33.74 97.81 232 9 SER A 50 ? ? -25.36 139.20 233 9 LYS A 51 ? ? -93.27 -114.56 234 9 LYS A 52 ? ? -156.75 -52.37 235 9 PRO A 53 ? ? -75.04 -106.24 236 9 GLU A 55 ? ? -36.31 73.50 237 9 THR A 58 ? ? -127.55 -146.98 238 9 CYS A 60 ? ? -179.07 114.69 239 9 THR A 62 ? ? -49.68 165.29 240 9 HIS A 68 ? ? -37.92 158.13 241 9 LYS A 70 ? ? -161.53 -38.19 242 9 GLN A 71 ? ? -61.16 59.98 243 9 PRO A 73 ? ? -74.90 -162.43 244 9 TYR B 4 ? ? -59.42 -165.79 245 9 GLU B 5 ? ? -106.36 40.84 246 9 SER B 6 ? ? -148.80 -7.72 247 9 PRO B 10 ? ? -75.08 22.62 248 10 THR A 8 ? ? -72.84 -105.26 249 10 SER A 9 ? ? -62.48 -161.20 250 10 ILE A 11 ? ? 165.94 100.34 251 10 LEU A 22 ? ? -173.95 -171.30 252 10 TRP A 28 ? ? -166.38 -101.34 253 10 CYS A 29 ? ? -176.17 119.11 254 10 ASP A 30 ? ? -47.71 177.69 255 10 CYS A 33 ? ? 37.50 61.34 256 10 SER A 34 ? ? -59.85 174.96 257 10 VAL A 39 ? ? -104.48 -161.57 258 10 VAL A 40 ? ? -153.98 76.72 259 10 LEU A 42 ? ? -66.54 -176.93 260 10 CYS A 48 ? ? -34.14 97.63 261 10 SER A 50 ? ? -25.21 139.41 262 10 LYS A 51 ? ? -93.76 -114.78 263 10 LYS A 52 ? ? -156.15 -52.42 264 10 PRO A 53 ? ? -74.96 -107.28 265 10 GLU A 55 ? ? -37.62 73.50 266 10 THR A 58 ? ? -127.34 -146.30 267 10 CYS A 60 ? ? -179.91 115.37 268 10 THR A 62 ? ? -49.23 164.90 269 10 HIS A 68 ? ? -37.36 156.15 270 10 LYS A 70 ? ? -163.76 -38.62 271 10 GLN A 71 ? ? -56.41 78.43 272 10 TYR B 4 ? ? -56.90 175.85 273 10 GLU B 5 ? ? -90.60 41.63 274 10 SER B 6 ? ? -145.27 -15.74 275 10 PRO B 10 ? ? -74.95 37.57 276 10 TRP B 11 ? ? -134.95 -40.31 277 11 THR A 8 ? ? -74.61 -103.82 278 11 SER A 9 ? ? -63.72 -161.49 279 11 ILE A 11 ? ? 166.17 103.31 280 11 LEU A 22 ? ? -173.43 -170.48 281 11 TRP A 28 ? ? -169.02 -101.45 282 11 CYS A 29 ? ? -174.75 120.33 283 11 ASP A 30 ? ? -48.63 177.78 284 11 CYS A 33 ? ? 37.16 61.49 285 11 VAL A 39 ? ? -104.77 -163.02 286 11 VAL A 40 ? ? -153.48 77.05 287 11 LEU A 42 ? ? -66.68 -178.68 288 11 CYS A 48 ? ? -34.28 97.50 289 11 SER A 50 ? ? -24.95 139.38 290 11 LYS A 51 ? ? -93.64 -114.54 291 11 LYS A 52 ? ? -156.50 -52.43 292 11 PRO A 53 ? ? -75.08 -106.92 293 11 GLU A 55 ? ? -36.52 73.13 294 11 THR A 58 ? ? -127.54 -148.15 295 11 CYS A 60 ? ? -179.69 114.89 296 11 THR A 62 ? ? -48.28 166.03 297 11 HIS A 68 ? ? -37.96 157.55 298 11 LYS A 70 ? ? -160.76 -43.50 299 11 GLN A 71 ? ? -55.50 84.88 300 11 ARG A 72 ? ? -146.20 -61.33 301 11 TYR B 4 ? ? -57.13 -165.92 302 11 SER B 6 ? ? -146.41 -7.05 303 11 PRO B 10 ? ? -75.06 32.40 304 12 THR A 8 ? ? -73.58 -103.90 305 12 SER A 9 ? ? -64.08 -161.24 306 12 ILE A 11 ? ? 166.55 102.72 307 12 LEU A 22 ? ? -173.74 -171.01 308 12 TRP A 28 ? ? -169.05 -101.25 309 12 CYS A 29 ? ? -175.16 120.62 310 12 ASP A 30 ? ? -49.53 178.05 311 12 CYS A 33 ? ? 35.98 59.64 312 12 VAL A 39 ? ? -104.38 -163.16 313 12 VAL A 40 ? ? -153.06 76.99 314 12 LEU A 42 ? ? -67.65 -177.90 315 12 CYS A 48 ? ? -34.96 97.63 316 12 SER A 50 ? ? -25.12 139.35 317 12 LYS A 51 ? ? -93.91 -114.57 318 12 LYS A 52 ? ? -156.52 -52.38 319 12 PRO A 53 ? ? -75.07 -106.33 320 12 GLU A 55 ? ? -37.08 72.76 321 12 THR A 58 ? ? -127.65 -146.03 322 12 CYS A 60 ? ? 179.89 116.06 323 12 THR A 62 ? ? -48.78 166.07 324 12 HIS A 68 ? ? -37.89 158.13 325 12 LYS A 70 ? ? -161.19 -40.13 326 12 GLN A 71 ? ? -60.99 66.39 327 12 TYR B 4 ? ? -58.02 -165.45 328 12 SER B 6 ? ? -149.33 -4.93 329 12 PRO B 10 ? ? -75.11 26.91 330 13 THR A 8 ? ? -74.02 -103.84 331 13 SER A 9 ? ? -63.45 -161.56 332 13 ILE A 11 ? ? 165.87 103.28 333 13 LEU A 22 ? ? -173.38 -170.81 334 13 TRP A 28 ? ? -168.39 -100.87 335 13 CYS A 29 ? ? -176.26 118.80 336 13 ASP A 30 ? ? -48.47 177.47 337 13 CYS A 33 ? ? 35.08 61.42 338 13 VAL A 39 ? ? -103.49 -163.27 339 13 VAL A 40 ? ? -153.06 76.47 340 13 LEU A 42 ? ? -66.87 -178.19 341 13 CYS A 48 ? ? -34.52 97.76 342 13 SER A 50 ? ? -25.26 139.57 343 13 LYS A 51 ? ? -93.84 -114.30 344 13 LYS A 52 ? ? -156.75 -52.52 345 13 PRO A 53 ? ? -74.97 -106.97 346 13 GLU A 55 ? ? -37.41 73.22 347 13 THR A 58 ? ? -127.12 -145.55 348 13 CYS A 60 ? ? 179.85 114.14 349 13 HIS A 68 ? ? -37.60 158.04 350 13 LYS A 70 ? ? -160.87 -38.74 351 13 GLN A 71 ? ? -61.76 61.20 352 13 TYR B 4 ? ? -58.87 -164.75 353 13 GLU B 5 ? ? -107.74 41.13 354 13 SER B 6 ? ? -152.90 -1.63 355 13 PRO B 10 ? ? -75.01 34.35 356 13 TRP B 11 ? ? -134.02 -37.67 357 14 THR A 8 ? ? -72.10 -104.23 358 14 SER A 9 ? ? -63.91 -161.24 359 14 ILE A 11 ? ? 165.58 101.18 360 14 LEU A 22 ? ? -175.99 -168.11 361 14 TRP A 28 ? ? -165.51 -101.23 362 14 CYS A 29 ? ? -174.56 121.53 363 14 ASP A 30 ? ? -48.76 178.31 364 14 CYS A 33 ? ? 37.30 61.60 365 14 VAL A 39 ? ? -106.28 -161.52 366 14 VAL A 40 ? ? -154.21 77.68 367 14 LEU A 42 ? ? -65.95 -175.97 368 14 ALA A 45 ? ? -170.69 143.29 369 14 CYS A 48 ? ? -37.89 99.36 370 14 SER A 50 ? ? -27.02 140.76 371 14 LYS A 51 ? ? -95.50 -113.75 372 14 LYS A 52 ? ? -156.54 -52.75 373 14 PRO A 53 ? ? -75.01 -106.38 374 14 GLU A 55 ? ? -38.07 72.26 375 14 THR A 58 ? ? -131.89 -155.38 376 14 CYS A 60 ? ? 177.06 112.11 377 14 THR A 62 ? ? -48.03 160.84 378 14 HIS A 68 ? ? -37.75 157.16 379 14 LYS A 70 ? ? -160.68 -39.74 380 14 GLN A 71 ? ? -57.67 75.44 381 14 TYR B 4 ? ? -52.45 -175.80 382 14 GLU B 5 ? ? -99.49 34.78 383 14 PRO B 10 ? ? -74.99 29.04 384 15 THR A 8 ? ? -74.90 -104.31 385 15 SER A 9 ? ? -63.16 -161.57 386 15 ILE A 11 ? ? 165.77 102.79 387 15 LEU A 22 ? ? -175.81 -171.39 388 15 CYS A 23 ? ? -103.77 -169.52 389 15 TRP A 28 ? ? -168.24 -101.68 390 15 CYS A 29 ? ? -177.00 118.25 391 15 ASP A 30 ? ? -48.81 176.60 392 15 CYS A 33 ? ? 34.83 60.36 393 15 SER A 34 ? ? -59.57 175.69 394 15 VAL A 39 ? ? -104.24 -164.03 395 15 VAL A 40 ? ? -152.40 76.28 396 15 LEU A 42 ? ? -66.62 -178.44 397 15 CYS A 48 ? ? -35.29 97.98 398 15 SER A 50 ? ? -25.54 139.63 399 15 LYS A 51 ? ? -93.94 -114.69 400 15 LYS A 52 ? ? -156.26 -52.49 401 15 PRO A 53 ? ? -75.03 -106.07 402 15 GLU A 55 ? ? -36.51 72.48 403 15 THR A 58 ? ? -127.62 -144.98 404 15 CYS A 60 ? ? 179.77 115.07 405 15 THR A 62 ? ? -49.22 165.16 406 15 HIS A 68 ? ? -38.53 158.01 407 15 LYS A 70 ? ? -161.95 -40.55 408 15 GLN A 71 ? ? -56.92 77.74 409 15 TYR B 4 ? ? -59.66 -165.63 410 15 GLU B 5 ? ? -106.51 41.37 411 15 SER B 6 ? ? -149.16 -9.68 412 15 PRO B 10 ? ? -74.97 36.54 413 15 TRP B 11 ? ? -135.14 -38.61 414 16 THR A 8 ? ? -72.48 -105.23 415 16 SER A 9 ? ? -61.96 -161.90 416 16 ILE A 11 ? ? 165.30 100.99 417 16 LEU A 22 ? ? -176.45 -167.39 418 16 TRP A 28 ? ? -166.28 -100.89 419 16 CYS A 29 ? ? -175.38 121.22 420 16 ASP A 30 ? ? -48.83 177.98 421 16 CYS A 33 ? ? 36.70 61.32 422 16 VAL A 39 ? ? -105.21 -161.40 423 16 VAL A 40 ? ? -154.30 77.32 424 16 LEU A 42 ? ? -66.69 -175.75 425 16 ALA A 45 ? ? -170.94 142.64 426 16 CYS A 48 ? ? -37.52 99.26 427 16 SER A 50 ? ? -26.70 139.93 428 16 LYS A 51 ? ? -94.75 -114.00 429 16 LYS A 52 ? ? -156.15 -53.13 430 16 PRO A 53 ? ? -75.04 -106.88 431 16 GLU A 55 ? ? -38.31 72.28 432 16 THR A 58 ? ? -132.06 -155.01 433 16 CYS A 60 ? ? 177.45 111.88 434 16 THR A 62 ? ? -48.97 160.32 435 16 HIS A 68 ? ? -38.93 157.82 436 16 LYS A 70 ? ? -159.87 -39.70 437 16 GLN A 71 ? ? -58.33 75.15 438 16 TYR B 4 ? ? -54.23 -171.70 439 16 SER B 6 ? ? -154.18 13.60 440 16 SER B 7 ? ? 171.77 159.72 441 16 PRO B 10 ? ? -75.05 23.70 442 17 THR A 8 ? ? -74.31 -103.75 443 17 SER A 9 ? ? -63.98 -161.52 444 17 ILE A 11 ? ? 166.08 103.04 445 17 LEU A 22 ? ? -172.85 -170.94 446 17 TRP A 28 ? ? -169.39 -101.60 447 17 CYS A 29 ? ? -174.71 120.21 448 17 ASP A 30 ? ? -49.14 178.14 449 17 CYS A 33 ? ? 36.26 60.58 450 17 VAL A 39 ? ? -104.95 -162.86 451 17 VAL A 40 ? ? -153.44 76.66 452 17 LEU A 42 ? ? -67.18 -177.82 453 17 CYS A 48 ? ? -33.83 97.54 454 17 SER A 50 ? ? -25.02 138.98 455 17 LYS A 51 ? ? -93.35 -114.47 456 17 LYS A 52 ? ? -156.75 -52.39 457 17 PRO A 53 ? ? -74.96 -106.60 458 17 GLU A 55 ? ? -37.00 73.14 459 17 THR A 58 ? ? -127.95 -146.32 460 17 CYS A 60 ? ? 179.94 115.12 461 17 THR A 62 ? ? -49.27 166.19 462 17 HIS A 68 ? ? -38.09 157.84 463 17 LYS A 70 ? ? -159.67 -38.55 464 17 GLN A 71 ? ? -62.31 59.79 465 17 ARG B 2 ? ? 177.11 165.76 466 17 TYR B 3 ? ? -115.32 50.01 467 17 TYR B 4 ? ? -59.10 -164.88 468 17 SER B 6 ? ? -153.05 6.09 469 17 PRO B 10 ? ? -74.97 36.99 470 17 TRP B 11 ? ? -136.46 -37.15 471 18 THR A 8 ? ? -72.95 -104.96 472 18 SER A 9 ? ? -63.14 -161.27 473 18 ILE A 11 ? ? 165.90 100.02 474 18 LEU A 22 ? ? -173.22 -170.89 475 18 TRP A 28 ? ? -165.58 -101.19 476 18 CYS A 29 ? ? -176.78 119.09 477 18 ASP A 30 ? ? -48.26 175.91 478 18 CYS A 33 ? ? 38.40 60.09 479 18 SER A 34 ? ? -59.17 175.82 480 18 VAL A 39 ? ? -103.79 -161.72 481 18 VAL A 40 ? ? -153.75 77.47 482 18 LEU A 42 ? ? -66.10 -176.92 483 18 CYS A 48 ? ? -35.72 97.85 484 18 SER A 50 ? ? -24.98 139.30 485 18 LYS A 51 ? ? -93.97 -114.58 486 18 LYS A 52 ? ? -156.33 -52.44 487 18 PRO A 53 ? ? -74.95 -106.75 488 18 GLU A 55 ? ? -37.40 72.07 489 18 THR A 58 ? ? -127.55 -145.93 490 18 CYS A 60 ? ? 179.77 114.60 491 18 THR A 62 ? ? -48.68 165.81 492 18 HIS A 68 ? ? -37.27 156.87 493 18 LYS A 70 ? ? -163.31 -40.07 494 18 GLN A 71 ? ? -53.53 80.41 495 18 TYR B 4 ? ? -56.50 175.09 496 18 GLU B 5 ? ? -88.76 40.33 497 18 SER B 6 ? ? -143.29 -12.22 498 18 PRO B 10 ? ? -74.99 26.86 499 19 THR A 8 ? ? -74.03 -103.93 500 19 SER A 9 ? ? -63.96 -161.35 501 19 ILE A 11 ? ? 165.99 102.45 502 19 LEU A 22 ? ? -174.42 -171.74 503 19 CYS A 23 ? ? -102.99 -169.50 504 19 TRP A 28 ? ? -169.17 -100.93 505 19 CYS A 29 ? ? -175.47 118.75 506 19 ASP A 30 ? ? -47.20 175.76 507 19 CYS A 33 ? ? 38.27 61.79 508 19 VAL A 39 ? ? -103.50 -163.45 509 19 VAL A 40 ? ? -152.93 76.95 510 19 LEU A 42 ? ? -66.41 -178.08 511 19 CYS A 48 ? ? -34.70 97.71 512 19 SER A 50 ? ? -25.07 139.64 513 19 LYS A 51 ? ? -93.90 -115.02 514 19 LYS A 52 ? ? -156.08 -52.40 515 19 PRO A 53 ? ? -75.01 -106.26 516 19 GLU A 55 ? ? -36.08 73.05 517 19 THR A 58 ? ? -127.34 -145.18 518 19 CYS A 60 ? ? 179.15 114.23 519 19 THR A 62 ? ? -48.47 165.49 520 19 HIS A 68 ? ? -37.42 157.72 521 19 LYS A 70 ? ? -160.53 -44.17 522 19 GLN A 71 ? ? -56.48 83.43 523 19 ARG A 72 ? ? -143.97 -61.47 524 19 TYR B 4 ? ? -58.53 -166.49 525 19 GLU B 5 ? ? -105.92 40.10 526 19 SER B 6 ? ? -146.64 -10.83 527 19 PRO B 10 ? ? -75.03 29.30 528 20 THR A 8 ? ? -72.30 -104.73 529 20 SER A 9 ? ? -63.10 -161.56 530 20 ILE A 11 ? ? 165.79 100.39 531 20 LEU A 22 ? ? -176.48 -168.28 532 20 TRP A 28 ? ? -167.26 -101.89 533 20 CYS A 29 ? ? -176.09 120.03 534 20 ASP A 30 ? ? -48.99 175.74 535 20 CYS A 33 ? ? 35.59 61.38 536 20 VAL A 39 ? ? -105.70 -162.41 537 20 VAL A 40 ? ? -153.29 77.76 538 20 LEU A 42 ? ? -65.58 -175.37 539 20 ALA A 45 ? ? -171.50 143.52 540 20 CYS A 48 ? ? -37.68 99.28 541 20 SER A 50 ? ? -26.87 140.41 542 20 LYS A 51 ? ? -95.25 -114.15 543 20 LYS A 52 ? ? -155.99 -52.87 544 20 PRO A 53 ? ? -75.00 -106.66 545 20 GLU A 55 ? ? -37.39 72.16 546 20 THR A 58 ? ? -131.76 -154.43 547 20 CYS A 60 ? ? 176.63 112.97 548 20 THR A 62 ? ? -47.67 162.38 549 20 HIS A 68 ? ? -37.68 156.41 550 20 LYS A 70 ? ? -163.29 -39.78 551 20 GLN A 71 ? ? -52.26 80.01 552 20 TYR B 4 ? ? -54.47 177.75 553 20 GLU B 5 ? ? -91.53 34.48 554 20 PRO B 10 ? ? -75.02 26.32 #