data_1I0U # _entry.id 1I0U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1I0U pdb_00001i0u 10.2210/pdb1i0u/pdb RCSB RCSB012765 ? ? WWPDB D_1000012765 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1F5Y '1F5Y contains ligand binding modules (LB1-2) of the human LDL receptor' unspecified PDB 1LRX '1LRX contains YWTD modules of the human LDL receptor' unspecified PDB 1HZ8 '1HZ8 is the ensemble of 30 structures' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1I0U _pdbx_database_status.recvd_initial_deposition_date 2001-01-29 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kurniawan, N.D.' 1 'Aliabadizadeh, K.' 2 'Brereton, I.M.' 3 'Kroon, P.A.' 4 'Smith, R.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR structure and backbone dynamics of a concatemer of epidermal growth factor homology modules of the human low-density lipoprotein receptor. ; J.Mol.Biol. 311 341 356 2001 JMOBAK UK 0022-2836 0070 ? 11478865 10.1006/jmbi.2001.4867 1 'NMR Structure of a Concatemer of the First and Second Ligand-Binding Modules of the Human Low-Density Lipoprotein Receptor' 'Protein Sci.' 9 1282 1293 2000 PRCIEI US 0961-8368 0795 ? ? ? 2 ;An extracellular beta-propeller module predicted in lipoprotein and scavenger receptors, tyrosine kinases,epidermal growth factor precursor, and extracellular matrix components. An extracellular beta-propeller module predicted in lipoprotein and scavenger receptors, tyrosine kinases,epidermal growth factor precursor, and extracellular matrix components ; J.Mol.Biol. 283 837 862 1998 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1998.2115 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kurniawan, N.D.' 1 ? primary 'Aliabadizadeh, K.' 2 ? primary 'Brereton, I.M.' 3 ? primary 'Kroon, P.A.' 4 ? primary 'Smith, R.' 5 ? 1 'Kurniawan, N.D.' 6 ? 1 'Atkins, A.R.' 7 ? 1 'Brereton, I.M.' 8 ? 1 'Kroon, P.A.' 9 ? 1 'Smith, R.' 10 ? 2 'Springer, T.A.' 11 ? # _cell.entry_id 1I0U _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'LOW DENSITY LIPOPROTEIN RECEPTOR' 9001.013 1 ? ? 'EGF-AB CONCATEMER(RESIDUES 314-395)' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LDL RECEPTOR' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK AV ; _entity_poly.pdbx_seq_one_letter_code_can ;GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACK AV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ASN n 1 4 GLU n 1 5 CYS n 1 6 LEU n 1 7 ASP n 1 8 ASN n 1 9 ASN n 1 10 GLY n 1 11 GLY n 1 12 CYS n 1 13 SER n 1 14 HIS n 1 15 VAL n 1 16 CYS n 1 17 ASN n 1 18 ASP n 1 19 LEU n 1 20 LYS n 1 21 ILE n 1 22 GLY n 1 23 TYR n 1 24 GLU n 1 25 CYS n 1 26 LEU n 1 27 CYS n 1 28 PRO n 1 29 ASP n 1 30 GLY n 1 31 PHE n 1 32 GLN n 1 33 LEU n 1 34 VAL n 1 35 ALA n 1 36 GLN n 1 37 ARG n 1 38 ARG n 1 39 CYS n 1 40 GLU n 1 41 ASP n 1 42 ILE n 1 43 ASP n 1 44 GLU n 1 45 CYS n 1 46 GLN n 1 47 ASP n 1 48 PRO n 1 49 ASP n 1 50 THR n 1 51 CYS n 1 52 SER n 1 53 GLN n 1 54 LEU n 1 55 CYS n 1 56 VAL n 1 57 ASN n 1 58 LEU n 1 59 GLU n 1 60 GLY n 1 61 GLY n 1 62 TYR n 1 63 LYS n 1 64 CYS n 1 65 GLN n 1 66 CYS n 1 67 GLU n 1 68 GLU n 1 69 GLY n 1 70 PHE n 1 71 GLN n 1 72 LEU n 1 73 ASP n 1 74 PRO n 1 75 HIS n 1 76 THR n 1 77 LYS n 1 78 ALA n 1 79 CYS n 1 80 LYS n 1 81 ALA n 1 82 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue LIVER _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'DH5-ALPHA; BL21-DE3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PGEX-4T; PET-30A+' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LDLR_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 314 _struct_ref.pdbx_db_accession P01130 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1I0U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01130 _struct_ref_seq.db_align_beg 314 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 395 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 5 1 HNHA 2 3 1 '2D NOESY' 3 4 1 '2D NOESY' 4 1 2 '2D NOESY' 5 1 2 DQF-COSY 6 5 3 3D_15N-separated_NOESY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 ambient 5.5 0.060 ? K 2 283 ambient 5.5 0.060 ? K 3 295 ambient 5.5 0.060 ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM EGF-AB, 20mM CaCl2' '95% H2O/5% D2O' 2 '1mM EGF-AB, 20mM CaCl2' '99% D2O' 3 '1mM 15N-EGF-AB, 20mM CaCl2' '95% H2O/5% D2O' 4 '1.5mM EGF-A, 20mM CaCl2' '99% D2O' 5 '1.5mM EGF-A, 20mM CaCl2' '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 750 # _pdbx_nmr_refine.entry_id 1I0U _pdbx_nmr_refine.method '1. Torsion angles dynamics 2. Restrained molecular dynamics with calcium 3. Energy minimisation' _pdbx_nmr_refine.details ;The structures are based on: 874 NOE restraints, 64 phi dihedral angles, 14 chi1 dihedral angles, 14 hydrogen bonds, 9 calcium ion ligand restraints ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1I0U _pdbx_nmr_details.text '15N T1, T2, and NOE relaxations to obtain backbone dynamics information T1/T2 data were not used for structure refinement' # _pdbx_nmr_ensemble.entry_id 1I0U _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'Energy minimised average structure from 30 selected structure with lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 Sparky 3.95 processing 'T. Goddard & D. G. Kneller' 2 DYANA 1.5 'structure solution' 'P. Guntert' 3 X-PLOR 3.85 refinement 'A. Brunger' 4 MOLMOL 2.6 'data analysis' 'R. Koradi' 5 # _exptl.entry_id 1I0U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1I0U _struct.title 'SOLUTION STRUCTURE AND BACKBONE DYNAMICS OF A CONCATEMER OF EGF-HOMOLOGY MODULES OF THE HUMAN LOW DENSITY LIPOPROTEIN RECEPTOR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1I0U _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'anti-parallel beta strands, calcium binding sites, LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 8 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 12 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 8 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 12 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 5 A CYS 16 1_555 ? ? ? ? ? ? ? 2.018 ? ? disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 25 SG ? ? A CYS 12 A CYS 25 1_555 ? ? ? ? ? ? ? 2.016 ? ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 27 A CYS 39 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf4 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 45 A CYS 55 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf5 disulf ? ? A CYS 51 SG ? ? ? 1_555 A CYS 64 SG ? ? A CYS 51 A CYS 64 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf6 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 66 A CYS 79 1_555 ? ? ? ? ? ? ? 2.018 ? ? metalc1 metalc ? ? A THR 2 O ? ? ? 1_555 B CA . CA ? ? A THR 2 A CA 83 1_555 ? ? ? ? ? ? ? 2.834 ? ? metalc2 metalc ? ? A GLU 4 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 4 A CA 83 1_555 ? ? ? ? ? ? ? 2.693 ? ? metalc3 metalc ? ? A GLU 4 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 4 A CA 83 1_555 ? ? ? ? ? ? ? 2.749 ? ? metalc4 metalc ? ? A GLU 4 N ? ? ? 1_555 B CA . CA ? ? A GLU 4 A CA 83 1_555 ? ? ? ? ? ? ? 3.165 ? ? metalc5 metalc ? ? A ASP 18 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 18 A CA 83 1_555 ? ? ? ? ? ? ? 2.705 ? ? metalc6 metalc ? ? A ASP 41 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 41 A CA 84 1_555 ? ? ? ? ? ? ? 2.724 ? ? metalc7 metalc ? ? A ILE 42 O ? ? ? 1_555 C CA . CA ? ? A ILE 42 A CA 84 1_555 ? ? ? ? ? ? ? 2.698 ? ? metalc8 metalc ? ? A GLU 44 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 44 A CA 84 1_555 ? ? ? ? ? ? ? 2.713 ? ? metalc9 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 44 A CA 84 1_555 ? ? ? ? ? ? ? 2.759 ? ? metalc10 metalc ? ? A ASN 57 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 57 A CA 84 1_555 ? ? ? ? ? ? ? 2.669 ? ? metalc11 metalc ? ? A LEU 58 O ? ? ? 1_555 C CA . CA ? ? A LEU 58 A CA 84 1_555 ? ? ? ? ? ? ? 2.760 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 15 ? ASN A 17 ? VAL A 15 ASN A 17 A 2 GLU A 24 ? LEU A 26 ? GLU A 24 LEU A 26 B 1 GLN A 32 ? ALA A 35 ? GLN A 32 ALA A 35 B 2 ARG A 38 ? GLU A 40 ? ARG A 38 GLU A 40 C 1 CYS A 55 ? VAL A 56 ? CYS A 55 VAL A 56 C 2 LYS A 63 ? CYS A 64 ? LYS A 63 CYS A 64 D 1 PHE A 70 ? LEU A 72 ? PHE A 70 LEU A 72 D 2 CYS A 79 ? ALA A 81 ? CYS A 79 ALA A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ASN A 17 ? O ASN A 17 N GLU A 24 ? N GLU A 24 B 1 2 O ALA A 35 ? O ALA A 35 N ARG A 38 ? N ARG A 38 C 1 2 N VAL A 56 ? N VAL A 56 O LYS A 63 ? O LYS A 63 D 1 2 N GLN A 71 ? N GLN A 71 O LYS A 80 ? O LYS A 80 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 83 ? 4 'BINDING SITE FOR RESIDUE CA A 83' AC2 Software A CA 84 ? 6 'BINDING SITE FOR RESIDUE CA A 84' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 THR A 2 ? THR A 2 . ? 1_555 ? 2 AC1 4 ASN A 3 ? ASN A 3 . ? 1_555 ? 3 AC1 4 GLU A 4 ? GLU A 4 . ? 1_555 ? 4 AC1 4 ASP A 18 ? ASP A 18 . ? 1_555 ? 5 AC2 6 ASP A 41 ? ASP A 41 . ? 1_555 ? 6 AC2 6 ILE A 42 ? ILE A 42 . ? 1_555 ? 7 AC2 6 GLU A 44 ? GLU A 44 . ? 1_555 ? 8 AC2 6 ASN A 57 ? ASN A 57 . ? 1_555 ? 9 AC2 6 LEU A 58 ? LEU A 58 . ? 1_555 ? 10 AC2 6 GLY A 60 ? GLY A 60 . ? 1_555 ? # _database_PDB_matrix.entry_id 1I0U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1I0U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 CYS 12 12 12 CYS CYS A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 VAL 82 82 82 VAL VAL A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 83 83 CA CA A . C 2 CA 1 84 84 CA CA A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A THR 2 ? A THR 2 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OE1 ? A GLU 4 ? A GLU 4 ? 1_555 104.2 ? 2 O ? A THR 2 ? A THR 2 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OE2 ? A GLU 4 ? A GLU 4 ? 1_555 58.2 ? 3 OE1 ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OE2 ? A GLU 4 ? A GLU 4 ? 1_555 46.9 ? 4 O ? A THR 2 ? A THR 2 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 N ? A GLU 4 ? A GLU 4 ? 1_555 78.1 ? 5 OE1 ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 N ? A GLU 4 ? A GLU 4 ? 1_555 75.3 ? 6 OE2 ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 N ? A GLU 4 ? A GLU 4 ? 1_555 59.9 ? 7 O ? A THR 2 ? A THR 2 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 61.9 ? 8 OE1 ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 76.6 ? 9 OE2 ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 64.2 ? 10 N ? A GLU 4 ? A GLU 4 ? 1_555 CA ? B CA . ? A CA 83 ? 1_555 OD1 ? A ASP 18 ? A ASP 18 ? 1_555 122.6 ? 11 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A ILE 42 ? A ILE 42 ? 1_555 65.9 ? 12 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OE1 ? A GLU 44 ? A GLU 44 ? 1_555 106.4 ? 13 O ? A ILE 42 ? A ILE 42 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OE1 ? A GLU 44 ? A GLU 44 ? 1_555 89.8 ? 14 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OE2 ? A GLU 44 ? A GLU 44 ? 1_555 62.8 ? 15 O ? A ILE 42 ? A ILE 42 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OE2 ? A GLU 44 ? A GLU 44 ? 1_555 58.1 ? 16 OE1 ? A GLU 44 ? A GLU 44 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OE2 ? A GLU 44 ? A GLU 44 ? 1_555 46.6 ? 17 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OD1 ? A ASN 57 ? A ASN 57 ? 1_555 162.2 ? 18 O ? A ILE 42 ? A ILE 42 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OD1 ? A ASN 57 ? A ASN 57 ? 1_555 101.4 ? 19 OE1 ? A GLU 44 ? A GLU 44 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OD1 ? A ASN 57 ? A ASN 57 ? 1_555 59.5 ? 20 OE2 ? A GLU 44 ? A GLU 44 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 OD1 ? A ASN 57 ? A ASN 57 ? 1_555 100.2 ? 21 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A LEU 58 ? A LEU 58 ? 1_555 131.0 ? 22 O ? A ILE 42 ? A ILE 42 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A LEU 58 ? A LEU 58 ? 1_555 144.2 ? 23 OE1 ? A GLU 44 ? A GLU 44 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A LEU 58 ? A LEU 58 ? 1_555 109.5 ? 24 OE2 ? A GLU 44 ? A GLU 44 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A LEU 58 ? A LEU 58 ? 1_555 153.8 ? 25 OD1 ? A ASN 57 ? A ASN 57 ? 1_555 CA ? C CA . ? A CA 84 ? 1_555 O ? A LEU 58 ? A LEU 58 ? 1_555 66.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-15 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 29 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 30 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 55 ? ? CB A CYS 55 ? ? SG A CYS 55 ? ? 122.78 114.20 8.58 1.10 N 2 1 CA A CYS 64 ? ? CB A CYS 64 ? ? SG A CYS 64 ? ? 121.32 114.20 7.12 1.10 N 3 1 CA A CYS 66 ? ? CB A CYS 66 ? ? SG A CYS 66 ? ? 126.21 114.20 12.01 1.10 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -64.57 -172.40 2 1 ASN A 9 ? ? -41.75 87.69 3 1 CYS A 12 ? ? -105.01 -129.77 4 1 SER A 13 ? ? -159.98 35.05 5 1 HIS A 14 ? ? -109.78 -104.48 6 1 ASP A 18 ? ? -52.36 86.55 7 1 TYR A 23 ? ? -34.32 154.44 8 1 VAL A 34 ? ? -79.74 -76.11 9 1 GLN A 36 ? ? 65.01 -66.96 10 1 ASP A 49 ? ? -140.77 -40.84 11 1 THR A 50 ? ? -75.57 -102.30 12 1 GLN A 53 ? ? -111.79 -113.69 13 1 LEU A 58 ? ? -176.35 -152.91 14 1 GLU A 68 ? ? 47.75 -79.00 15 1 THR A 76 ? ? -140.05 -37.79 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #