data_1I25 # _entry.id 1I25 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1I25 RCSB RCSB012808 WWPDB D_1000012808 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1I25 _pdbx_database_status.recvd_initial_deposition_date 2001-02-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shu, Q.' 1 'Lu, S.Y.' 2 'Gu, X.C.' 3 'Liang, S.P.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'The structure of spider toxin huwentoxin-II with unique disulfide linkage: evidence for structural evolution.' 'Protein Sci.' 11 245 252 2002 PRCIEI US 0961-8368 0795 ? 11790834 10.1110/ps.30502 1 'Sequence-specific Assignment of 1H-NMR Resonance and Determination of the Secondary Structure of HWTX-II' 'ACTA BIOCHIM.BIOPHYS.SINICA' 33 65 70 2001 ? CN 0582-9879 ? ? ? ? 2 'Assignment of Disulfide Bonds of Huwentoxin-II by Edman Degradation Sequencing and Stepwise Thiol Modification' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 3 ;Purification and Characterization of Huwentoxin-II, a Neurotoxic Peptide from the Venom of the Chinese Bird Spider Selenocosmia huwena ; J.PEPT.RES. 53 486 491 1999 JPERFA DK 1397-002X 2150 ? ? 10.1034/j.1399-3011.1999.00039.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Shu, Q.' 1 primary 'Lu, S.Y.' 2 primary 'Gu, X.C.' 3 primary 'Liang, S.P.' 4 1 'Shu, Q.' 5 1 'Lu, S.Y.' 6 1 'Gu, X.C.' 7 1 'Liang, S.P.' 8 2 'Shu, Q.' 9 2 'Huang, R.H.' 10 2 'Liang, S.P.' 11 3 'Shu, Q.' 12 3 'Liang, S.P.' 13 # _cell.entry_id 1I25 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1I25 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description HUWENTOXIN-II _entity.formula_weight 4300.246 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HWTX-II # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code LFECSFSCEIEKEGDKPCKKKKCKGGWKCKFNMCVKV _entity_poly.pdbx_seq_one_letter_code_can LFECSFSCEIEKEGDKPCKKKKCKGGWKCKFNMCVKV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 PHE n 1 3 GLU n 1 4 CYS n 1 5 SER n 1 6 PHE n 1 7 SER n 1 8 CYS n 1 9 GLU n 1 10 ILE n 1 11 GLU n 1 12 LYS n 1 13 GLU n 1 14 GLY n 1 15 ASP n 1 16 LYS n 1 17 PRO n 1 18 CYS n 1 19 LYS n 1 20 LYS n 1 21 LYS n 1 22 LYS n 1 23 CYS n 1 24 LYS n 1 25 GLY n 1 26 GLY n 1 27 TRP n 1 28 LYS n 1 29 CYS n 1 30 LYS n 1 31 PHE n 1 32 ASN n 1 33 MET n 1 34 CYS n 1 35 VAL n 1 36 LYS n 1 37 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Chinese earth tiger' _entity_src_nat.pdbx_organism_scientific 'Ornithoctonus huwena' _entity_src_nat.pdbx_ncbi_taxonomy_id 29017 _entity_src_nat.genus Ornithoctonus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ 'VENOM GLAND' _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details VENOM # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXH21_ORNHU _struct_ref.pdbx_db_accession P82959 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 49 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1I25 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 37 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P82959 _struct_ref_seq.db_align_beg 49 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 NOESY 2 1 1 DQF-COSY 3 1 1 TOCSY 4 2 1 NOESY 5 2 1 E-COSY 6 2 1 TOCSY 7 1 2 NOESY 8 1 2 TOCSY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 1 5.4 20 atm K 2 290 1 5.4 ? atm K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '4 mM Huwentoxin-II; 20 mmol/l phosphate buffer; 90%H2O , 10%D2O' '90% H2O/10% D2O' 2 '4 mM Huwentoxin-II; 20 mmol/l phosphate buffer; 100%D2O' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1I25 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on 592 NOE-derived distance constraints, 16 dihedral angel restraints and 9 fake distance restraints from disulfide bonds. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1I25 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1I25 _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1I25 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal FELIX 98.0 'data analysis' 'Molecular Simulations, Inc.' 1 X-PLOR 3.851 refinement Brunger 2 # _exptl.entry_id 1I25 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1I25 _struct.title 'Three dimensional solution structure of huwentoxin-II by 2D 1H-NMR' _struct.pdbx_descriptor HUWENTOXIN-II _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1I25 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'neurotoxin, insecticidal toxin, disulfide bonds, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 18 SG ? ? A CYS 4 A CYS 18 1_555 ? ? ? ? ? ? ? 2.019 ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 8 A CYS 29 1_555 ? ? ? ? ? ? ? 2.020 ? disulf3 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 23 A CYS 34 1_555 ? ? ? ? ? ? ? 2.020 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 27 ? CYS A 29 ? TRP A 27 CYS A 29 A 2 CYS A 34 ? LYS A 36 ? CYS A 34 LYS A 36 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 28 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 28 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 35 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 35 # _database_PDB_matrix.entry_id 1I25 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1I25 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 1 1 LEU LEU A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TRP 27 27 27 TRP TRP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-02-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_struct_assembly 2 4 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' struct_conf # _pdbx_database_remark.id 750 _pdbx_database_remark.text ;TURN DETERMINATION METHOD: AUTHOR-DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 11 ? ? -91.93 42.56 2 1 LYS A 30 ? ? -102.77 -148.07 3 1 ASN A 32 ? ? -142.27 32.87 4 2 MET A 33 ? ? -161.14 -166.36 5 3 GLU A 11 ? ? -89.48 49.09 6 3 LYS A 30 ? ? -88.39 -152.75 7 3 ASN A 32 ? ? -146.48 36.54 8 4 LYS A 30 ? ? -80.86 -155.86 9 5 PHE A 6 ? ? -147.14 -45.54 10 5 GLU A 11 ? ? -92.52 32.47 11 5 LYS A 30 ? ? -92.95 -152.58 12 5 ASN A 32 ? ? -149.66 30.95 13 6 GLU A 11 ? ? -103.29 48.59 14 6 ASP A 15 ? ? -140.09 46.17 15 6 LYS A 30 ? ? -83.43 -153.19 16 6 ASN A 32 ? ? -152.47 33.35 17 7 GLU A 11 ? ? -97.71 40.07 18 7 LYS A 30 ? ? -92.42 -147.54 19 7 ASN A 32 ? ? -143.11 37.67 20 8 CYS A 23 ? ? -101.83 -167.49 21 8 LYS A 30 ? ? -92.37 -118.08 22 8 ASN A 32 ? ? -146.99 39.26 23 9 LYS A 30 ? ? -104.59 -147.97 24 9 ASN A 32 ? ? -148.97 33.96 25 10 PHE A 2 ? ? -89.98 -138.82 26 10 GLU A 11 ? ? -92.65 37.02 27 10 GLU A 13 ? ? -98.31 38.86 28 10 LYS A 30 ? ? -106.62 -148.47 29 10 ASN A 32 ? ? -154.14 39.08 #