data_1I5U # _entry.id 1I5U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1I5U pdb_00001i5u 10.2210/pdb1i5u/pdb RCSB RCSB012941 ? ? WWPDB D_1000012941 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1I5T '1I5T contains SOLUTION STRUCTURE OF CYANOFERRICYTOCHROME C' unspecified PDB 1aw3 '1aw3 contains Solution NMR Structure Of Oxidized Rat Microsomal Cytochrome B5' unspecified PDB 1F04 '1F04 contains Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44A/E48A/E56A/D60A)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1I5U _pdbx_database_status.recvd_initial_deposition_date 2001-02-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Qian, C.' 1 'Yao, Y.' 2 'Tang, W.' 3 'Wang, J.' 4 'Zhongxian, H.' 5 # _citation.id primary _citation.title ;Effects of charged amino-acid mutation on the solution structure of cytochrome b(5) and binding between cytochrome b(5) and cytochrome c. ; _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 10 _citation.page_first 2451 _citation.page_last 2459 _citation.year 2001 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11714912 _citation.pdbx_database_id_DOI 10.1110/ps.ps.12401 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Qian, C.' 1 ? primary 'Yao, Y.' 2 ? primary 'Ye, K.' 3 ? primary 'Wang, J.' 4 ? primary 'Tang, W.' 5 ? primary 'Wang, Y.' 6 ? primary 'Wang, W.' 7 ? primary 'Lu, J.' 8 ? primary 'Xie, Y.' 9 ? primary 'Huang, Z.' 10 ? # _cell.entry_id 1I5U _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1I5U _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME B5' 9315.297 1 ? E48A/E56A/D60A 'SOLUBLE DOMAIN (RESIDUES 8-89)' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLRAQAGGDATANFEAVGHSTDARELSKTFIIGELHPD DR ; _entity_poly.pdbx_seq_one_letter_code_can ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLRAQAGGDATANFEAVGHSTDARELSKTFIIGELHPD DR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 LYS n 1 4 TYR n 1 5 TYR n 1 6 THR n 1 7 LEU n 1 8 GLU n 1 9 GLU n 1 10 ILE n 1 11 GLN n 1 12 LYS n 1 13 HIS n 1 14 ASN n 1 15 ASN n 1 16 SER n 1 17 LYS n 1 18 SER n 1 19 THR n 1 20 TRP n 1 21 LEU n 1 22 ILE n 1 23 LEU n 1 24 HIS n 1 25 TYR n 1 26 LYS n 1 27 VAL n 1 28 TYR n 1 29 ASP n 1 30 LEU n 1 31 THR n 1 32 LYS n 1 33 PHE n 1 34 LEU n 1 35 GLU n 1 36 GLU n 1 37 HIS n 1 38 PRO n 1 39 GLY n 1 40 GLY n 1 41 GLU n 1 42 GLU n 1 43 VAL n 1 44 LEU n 1 45 ARG n 1 46 ALA n 1 47 GLN n 1 48 ALA n 1 49 GLY n 1 50 GLY n 1 51 ASP n 1 52 ALA n 1 53 THR n 1 54 ALA n 1 55 ASN n 1 56 PHE n 1 57 GLU n 1 58 ALA n 1 59 VAL n 1 60 GLY n 1 61 HIS n 1 62 SER n 1 63 THR n 1 64 ASP n 1 65 ALA n 1 66 ARG n 1 67 GLU n 1 68 LEU n 1 69 SER n 1 70 LYS n 1 71 THR n 1 72 PHE n 1 73 ILE n 1 74 ILE n 1 75 GLY n 1 76 GLU n 1 77 LEU n 1 78 HIS n 1 79 PRO n 1 80 ASP n 1 81 ASP n 1 82 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PUC19 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD DR ; _struct_ref.pdbx_db_accession P00171 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1I5U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00171 _struct_ref_seq.db_align_beg 8 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1I5U ALA A 46 ? UNP P00171 GLU 53 'engineered mutation' 48 1 1 1I5U ALA A 54 ? UNP P00171 GLU 61 'engineered mutation' 56 2 1 1I5U ALA A 58 ? UNP P00171 ASP 65 'engineered mutation' 60 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 TOCSY 4 1 2 '2D NOESY' 5 1 2 DQF-COSY 6 1 2 TOCSY # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 303 1 7.0 ? atm K 2 303 1 7.0 ? atm K 3 303 1 7.0 ? atm K 4 303 1 7.0 ? atm K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '4mM cytochrome b5 triple mutant(E48A/E56A/D60A)' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1I5U _pdbx_nmr_refine.method 'distance geometry simulated annealing molecular dynamics' _pdbx_nmr_refine.details ;the structures are based on a total of 1522 meaningful NOE-derived distance constraints, together with 190 pseudocontact shift constraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1I5U _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1I5U _pdbx_nmr_ensemble.conformers_calculated_total_number 36 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria 'Minimized Average Structure' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA ? 'structure solution' ? 1 XwinNMR ? processing ? 2 AURELIA ? 'data analysis' ? 3 pseudyana ? 'structure solution' ? 4 XEASY ? 'data analysis' ? 5 Amber ? refinement ? 6 # _exptl.entry_id 1I5U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1I5U _struct.title 'SOLUTION STRUCTURE OF CYTOCHROME B5 TRIPLE MUTANT (E48A/E56A/D60A)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1I5U _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'Electron transport, Transmembrane, Heme, Microsome' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? HIS A 13 ? THR A 8 HIS A 15 1 ? 8 HELX_P HELX_P2 2 THR A 31 ? LEU A 34 ? THR A 33 LEU A 36 5 ? 4 HELX_P HELX_P3 3 GLY A 40 ? ALA A 48 ? GLY A 42 ALA A 50 1 ? 9 HELX_P HELX_P4 4 ALA A 52 ? VAL A 59 ? ALA A 54 VAL A 61 1 ? 8 HELX_P HELX_P5 5 SER A 62 ? PHE A 72 ? SER A 64 PHE A 74 1 ? 11 HELX_P HELX_P6 6 PRO A 79 ? ARG A 82 ? PRO A 81 ARG A 84 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 37 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 201 1_555 ? ? ? ? ? ? ? 1.998 ? ? metalc2 metalc ? ? A HIS 61 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 201 1_555 ? ? ? ? ? ? ? 1.987 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 4 ? TYR A 5 ? TYR A 6 TYR A 7 A 2 ILE A 73 ? LEU A 77 ? ILE A 75 LEU A 79 A 3 LYS A 26 ? ASP A 29 ? LYS A 28 ASP A 31 A 4 SER A 18 ? LEU A 23 ? SER A 20 LEU A 25 A 5 ASN A 14 ? ASN A 15 ? ASN A 16 ASN A 17 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 5 ? N TYR A 7 O GLU A 76 ? O GLU A 78 A 2 3 O GLY A 75 ? O GLY A 77 N VAL A 27 ? N VAL A 29 A 3 4 N TYR A 28 ? N TYR A 30 O LEU A 21 ? O LEU A 23 A 4 5 O SER A 18 ? O SER A 20 N ASN A 15 ? N ASN A 17 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 13 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 13 LEU A 30 ? LEU A 32 . ? 1_555 ? 2 AC1 13 PHE A 33 ? PHE A 35 . ? 1_555 ? 3 AC1 13 HIS A 37 ? HIS A 39 . ? 1_555 ? 4 AC1 13 PRO A 38 ? PRO A 40 . ? 1_555 ? 5 AC1 13 GLY A 39 ? GLY A 41 . ? 1_555 ? 6 AC1 13 VAL A 43 ? VAL A 45 . ? 1_555 ? 7 AC1 13 ASN A 55 ? ASN A 57 . ? 1_555 ? 8 AC1 13 PHE A 56 ? PHE A 58 . ? 1_555 ? 9 AC1 13 HIS A 61 ? HIS A 63 . ? 1_555 ? 10 AC1 13 SER A 62 ? SER A 64 . ? 1_555 ? 11 AC1 13 ALA A 65 ? ALA A 67 . ? 1_555 ? 12 AC1 13 LEU A 68 ? LEU A 70 . ? 1_555 ? 13 AC1 13 SER A 69 ? SER A 71 . ? 1_555 ? # _database_PDB_matrix.entry_id 1I5U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1I5U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 3 3 ALA ALA A . n A 1 2 VAL 2 4 4 VAL VAL A . n A 1 3 LYS 3 5 5 LYS LYS A . n A 1 4 TYR 4 6 6 TYR TYR A . n A 1 5 TYR 5 7 7 TYR TYR A . n A 1 6 THR 6 8 8 THR THR A . n A 1 7 LEU 7 9 9 LEU LEU A . n A 1 8 GLU 8 10 10 GLU GLU A . n A 1 9 GLU 9 11 11 GLU GLU A . n A 1 10 ILE 10 12 12 ILE ILE A . n A 1 11 GLN 11 13 13 GLN GLN A . n A 1 12 LYS 12 14 14 LYS LYS A . n A 1 13 HIS 13 15 15 HIS HIS A . n A 1 14 ASN 14 16 16 ASN ASN A . n A 1 15 ASN 15 17 17 ASN ASN A . n A 1 16 SER 16 18 18 SER SER A . n A 1 17 LYS 17 19 19 LYS LYS A . n A 1 18 SER 18 20 20 SER SER A . n A 1 19 THR 19 21 21 THR THR A . n A 1 20 TRP 20 22 22 TRP TRP A . n A 1 21 LEU 21 23 23 LEU LEU A . n A 1 22 ILE 22 24 24 ILE ILE A . n A 1 23 LEU 23 25 25 LEU LEU A . n A 1 24 HIS 24 26 26 HIS HIS A . n A 1 25 TYR 25 27 27 TYR TYR A . n A 1 26 LYS 26 28 28 LYS LYS A . n A 1 27 VAL 27 29 29 VAL VAL A . n A 1 28 TYR 28 30 30 TYR TYR A . n A 1 29 ASP 29 31 31 ASP ASP A . n A 1 30 LEU 30 32 32 LEU LEU A . n A 1 31 THR 31 33 33 THR THR A . n A 1 32 LYS 32 34 34 LYS LYS A . n A 1 33 PHE 33 35 35 PHE PHE A . n A 1 34 LEU 34 36 36 LEU LEU A . n A 1 35 GLU 35 37 37 GLU GLU A . n A 1 36 GLU 36 38 38 GLU GLU A . n A 1 37 HIS 37 39 39 HIS HIS A . n A 1 38 PRO 38 40 40 PRO PRO A . n A 1 39 GLY 39 41 41 GLY GLY A . n A 1 40 GLY 40 42 42 GLY GLY A . n A 1 41 GLU 41 43 43 GLU GLU A . n A 1 42 GLU 42 44 44 GLU GLU A . n A 1 43 VAL 43 45 45 VAL VAL A . n A 1 44 LEU 44 46 46 LEU LEU A . n A 1 45 ARG 45 47 47 ARG ARG A . n A 1 46 ALA 46 48 48 ALA ALA A . n A 1 47 GLN 47 49 49 GLN GLN A . n A 1 48 ALA 48 50 50 ALA ALA A . n A 1 49 GLY 49 51 51 GLY GLY A . n A 1 50 GLY 50 52 52 GLY GLY A . n A 1 51 ASP 51 53 53 ASP ASP A . n A 1 52 ALA 52 54 54 ALA ALA A . n A 1 53 THR 53 55 55 THR THR A . n A 1 54 ALA 54 56 56 ALA ALA A . n A 1 55 ASN 55 57 57 ASN ASN A . n A 1 56 PHE 56 58 58 PHE PHE A . n A 1 57 GLU 57 59 59 GLU GLU A . n A 1 58 ALA 58 60 60 ALA ALA A . n A 1 59 VAL 59 61 61 VAL VAL A . n A 1 60 GLY 60 62 62 GLY GLY A . n A 1 61 HIS 61 63 63 HIS HIS A . n A 1 62 SER 62 64 64 SER SER A . n A 1 63 THR 63 65 65 THR THR A . n A 1 64 ASP 64 66 66 ASP ASP A . n A 1 65 ALA 65 67 67 ALA ALA A . n A 1 66 ARG 66 68 68 ARG ARG A . n A 1 67 GLU 67 69 69 GLU GLU A . n A 1 68 LEU 68 70 70 LEU LEU A . n A 1 69 SER 69 71 71 SER SER A . n A 1 70 LYS 70 72 72 LYS LYS A . n A 1 71 THR 71 73 73 THR THR A . n A 1 72 PHE 72 74 74 PHE PHE A . n A 1 73 ILE 73 75 75 ILE ILE A . n A 1 74 ILE 74 76 76 ILE ILE A . n A 1 75 GLY 75 77 77 GLY GLY A . n A 1 76 GLU 76 78 78 GLU GLU A . n A 1 77 LEU 77 79 79 LEU LEU A . n A 1 78 HIS 78 80 80 HIS HIS A . n A 1 79 PRO 79 81 81 PRO PRO A . n A 1 80 ASP 80 82 82 ASP ASP A . n A 1 81 ASP 81 83 83 ASP ASP A . n A 1 82 ARG 82 84 84 ARG ARG A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NA ? B HEM . ? A HEM 201 ? 1_555 91.6 ? 2 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 95.0 ? 3 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NB ? B HEM . ? A HEM 201 ? 1_555 89.9 ? 4 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 88.0 ? 5 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 179.4 ? 6 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NC ? B HEM . ? A HEM 201 ? 1_555 89.7 ? 7 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 85.8 ? 8 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 90.9 ? 9 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 178.9 ? 10 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 ND ? B HEM . ? A HEM 201 ? 1_555 89.4 ? 11 NE2 ? A HIS 37 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 175.9 ? 12 NA ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 90.6 ? 13 NB ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 88.5 ? 14 NC ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 89.9 ? 15 ND ? B HEM . ? A HEM 201 ? 1_555 FE ? B HEM . ? A HEM 201 ? 1_555 NE2 ? A HIS 61 ? A HIS 63 ? 1_555 90.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-03-21 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 20 ? ? -168.93 106.54 2 1 HIS A 63 ? ? 62.66 118.62 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 27 ? ? 0.087 'SIDE CHAIN' 2 1 ARG A 68 ? ? 0.113 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id ALA _pdbx_validate_chiral.auth_seq_id 3 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM #