data_1I6G # _entry.id 1I6G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1I6G pdb_00001i6g 10.2210/pdb1i6g/pdb RCSB RCSB012963 ? ? WWPDB D_1000012963 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1NRB 'Neurotoxin CsE-V' unspecified PDB 1B3C 'Neurotoxin CsE-I' unspecified PDB 1IGF 'Neurotoxin CsE-v5 minimized average structure' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1I6G _pdbx_database_status.recvd_initial_deposition_date 2001-03-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jablonsky, M.J.' 1 'Jackson, P.L.' 2 'Krishna, N.R.' 3 # _citation.id primary _citation.title 'Solution structure of an insect-specific neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.' _citation.journal_abbrev Biochemistry _citation.journal_volume 40 _citation.page_first 8273 _citation.page_last 8282 _citation.year 2001 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11444973 _citation.pdbx_database_id_DOI 10.1021/bi010223h # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jablonsky, M.J.' 1 ? primary 'Jackson, P.L.' 2 ? primary 'Krishna, N.R.' 3 ? # _cell.entry_id 1I6G _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'NEUROTOXIN V-5' _entity.formula_weight 6370.235 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name CSE-V5 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG _entity_poly.pdbx_seq_one_letter_code_can KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ASP n 1 3 GLY n 1 4 TYR n 1 5 PRO n 1 6 VAL n 1 7 ASP n 1 8 SER n 1 9 LYS n 1 10 GLY n 1 11 CYS n 1 12 LYS n 1 13 LEU n 1 14 SER n 1 15 CYS n 1 16 VAL n 1 17 ALA n 1 18 ASN n 1 19 ASN n 1 20 TYR n 1 21 CYS n 1 22 ASP n 1 23 ASN n 1 24 GLN n 1 25 CYS n 1 26 LYS n 1 27 MET n 1 28 LYS n 1 29 LYS n 1 30 ALA n 1 31 SER n 1 32 GLY n 1 33 GLY n 1 34 HIS n 1 35 CYS n 1 36 TYR n 1 37 ALA n 1 38 MET n 1 39 SER n 1 40 CYS n 1 41 TYR n 1 42 CYS n 1 43 GLU n 1 44 GLY n 1 45 LEU n 1 46 PRO n 1 47 GLU n 1 48 ASN n 1 49 ALA n 1 50 LYS n 1 51 VAL n 1 52 SER n 1 53 ASP n 1 54 SER n 1 55 ALA n 1 56 THR n 1 57 ASN n 1 58 ILE n 1 59 CYS n 1 60 GLY n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'bark scorpion' _entity_src_nat.pdbx_organism_scientific 'Centruroides sculpturatus' _entity_src_nat.pdbx_ncbi_taxonomy_id 218467 _entity_src_nat.genus Centruroides _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant 5 _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCX5_CENSC _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNIC _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P58779 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1I6G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P58779 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1I6G _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 60 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P58779 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'SEE REMARK 999' _struct_ref_seq_dif.pdbx_auth_seq_num 60 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 TOCSY 3 2 1 '2D NOESY' 4 2 1 DQF-COSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM CsE-v5, pH 4.0' '90% H20, 10% D2O' 2 '1mM CsE-v5, pH 4.0' '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AM _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1I6G _pdbx_nmr_refine.method ;distance geometry simulated annealing ; _pdbx_nmr_refine.details ;The structures are based on 1010 total restraints: 849 distance, 70 H-bonds, 91 dihedral angle ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1I6G _pdbx_nmr_details.text 'This structure was determined using standard homonuclear 2D-NMR techniques.' # _pdbx_nmr_ensemble.entry_id 1I6G _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DISNMR disr88 collection Bruker 1 Felix 9.80 processing Biosym 2 X-PLOR 3.851 refinement Brunger 3 # _exptl.entry_id 1I6G _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1I6G _struct.title 'NMR SOLUTION STRUCTURE OF THE INSECT-SPECIFIC NEUROTOXIN VARIANT 5 (CSE-V5) FROM THE SCORPION CENTRUROIDES SCULPTURATUS EWING' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1I6G _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'scorpion, neurotoxin, sodium channel, alpha helix, beta sheet, disulfide linkages, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ALA _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 17 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 28 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ALA _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 17 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 28 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 59 SG ? ? A CYS 11 A CYS 59 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 15 A CYS 35 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 21 A CYS 40 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf4 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 25 A CYS 42 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 32 ? TYR A 36 ? GLY A 32 TYR A 36 A 2 SER A 39 ? GLU A 43 ? SER A 39 GLU A 43 A 3 ASP A 2 ? PRO A 5 ? ASP A 2 PRO A 5 A 4 VAL A 51 ? SER A 52 ? VAL A 51 SER A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 36 ? N TYR A 36 O SER A 39 ? O SER A 39 A 2 3 N CYS A 42 ? N CYS A 42 O GLY A 3 ? O GLY A 3 A 3 4 O TYR A 4 ? O TYR A 4 N SER A 52 ? N SER A 52 # _database_PDB_matrix.entry_id 1I6G _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1I6G _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 1 1 LYS LYS A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 GLY 60 60 60 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-08-01 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The authors have found that the previously published sequence (PIR C23727) was incorrect. They have demonstrated the existence of an additional Gly, 60, from sequencing, NMR, and mass spec. (Data included in the primary citation article). ; # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 H A SER 31 ? ? O A GLU 43 ? ? 1.58 2 6 O A LYS 1 ? ? H A LEU 45 ? ? 1.60 3 7 O A CYS 21 ? ? H A CYS 25 ? ? 1.57 4 11 O A PRO 46 ? ? H A ALA 49 ? ? 1.60 5 12 HG A SER 54 ? ? O A THR 56 ? ? 1.51 6 13 H1 A LYS 1 ? ? O A LEU 45 ? ? 1.55 7 14 H A SER 31 ? ? O A GLU 43 ? ? 1.60 8 16 H A SER 31 ? ? O A GLU 43 ? ? 1.60 9 18 H3 A LYS 1 ? ? O A LEU 45 ? ? 1.56 10 19 OD1 A ASP 7 ? ? H A GLY 10 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? -106.75 -164.53 2 1 LYS A 28 ? ? -90.67 43.25 3 1 LYS A 29 ? ? 43.91 27.36 4 1 SER A 31 ? ? -139.43 -36.95 5 1 MET A 38 ? ? 59.23 11.98 6 1 LYS A 50 ? ? -104.35 77.05 7 1 ILE A 58 ? ? -105.36 60.73 8 2 LYS A 28 ? ? -95.27 34.10 9 3 THR A 56 ? ? -142.88 54.71 10 4 VAL A 16 ? ? -158.33 -36.95 11 4 LYS A 29 ? ? 73.17 42.33 12 4 THR A 56 ? ? -99.01 56.53 13 5 LYS A 12 ? ? -56.77 173.53 14 5 SER A 31 ? ? -134.40 -40.04 15 5 MET A 38 ? ? 52.59 18.43 16 7 ASP A 7 ? ? -104.18 -168.64 17 7 LYS A 12 ? ? -48.03 159.34 18 7 LYS A 29 ? ? 70.38 43.02 19 7 LEU A 45 ? ? -43.26 169.88 20 7 THR A 56 ? ? -150.08 55.54 21 8 SER A 14 ? ? -37.37 135.97 22 8 LYS A 28 ? ? -99.02 39.49 23 8 LYS A 29 ? ? 58.74 19.36 24 8 MET A 38 ? ? 53.87 16.31 25 8 ASP A 53 ? ? -99.10 32.14 26 8 ILE A 58 ? ? -109.87 51.69 27 9 LEU A 45 ? ? -48.59 167.55 28 10 MET A 38 ? ? 59.70 17.36 29 11 ASP A 7 ? ? -109.96 -164.78 30 11 LYS A 28 ? ? -92.97 43.18 31 11 LEU A 45 ? ? -42.41 162.09 32 12 VAL A 16 ? ? -143.67 -36.71 33 12 LYS A 28 ? ? -94.05 34.85 34 12 ILE A 58 ? ? -114.86 56.59 35 13 LYS A 28 ? ? -87.70 33.75 36 13 MET A 38 ? ? 57.21 17.84 37 13 LEU A 45 ? ? -41.50 160.23 38 14 LYS A 28 ? ? -84.22 42.85 39 14 THR A 56 ? ? -144.10 53.70 40 14 CYS A 59 ? ? -92.45 -139.64 41 15 ASP A 7 ? ? -106.34 -169.93 42 15 THR A 56 ? ? -160.35 95.23 43 15 CYS A 59 ? ? -121.97 -165.58 44 16 ASP A 7 ? ? -108.45 -168.23 45 16 MET A 38 ? ? 59.28 14.29 46 16 LEU A 45 ? ? -48.42 163.11 47 17 SER A 31 ? ? -138.69 -37.90 48 17 ASP A 53 ? ? -86.13 31.95 49 17 CYS A 59 ? ? -89.29 41.58 50 19 LYS A 50 ? ? -103.53 74.87 51 20 MET A 38 ? ? 57.96 16.59 52 20 ILE A 58 ? ? -106.96 63.74 #