data_1IB7 # _entry.id 1IB7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IB7 pdb_00001ib7 10.2210/pdb1ib7/pdb RCSB RCSB013120 ? ? WWPDB D_1000013120 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-04-04 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site 9 5 'Structure model' chem_comp_atom 10 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_struct_conn.pdbx_dist_value' 10 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 11 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 13 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 14 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 15 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 16 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 22 4 'Structure model' '_struct_ref_seq_dif.details' 23 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IB7 _pdbx_database_status.recvd_initial_deposition_date 2001-03-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1b5a _pdbx_database_related.details 'WILD TYPE FERRO CYTOCHROME B5, SOLUTION STRUCTURE' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Shahzad, N.' 1 'Dangi, B.' 2 'Blankman, J.I.' 3 'Guiles, R.D.' 4 # _citation.id primary _citation.title 'MUTAGENIC MODULATION OF THE ENTROPY CHANGE ON OXIDATION OF CYTOCHROME B5: AN ANALYSIS OF THE CONTRIBUTION OF CONFORMATIONAL ENTROPY' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shahzad, N.' 1 ? primary 'Dangi, B.' 2 ? primary 'Blankman, J.I.' 3 ? primary 'Guiles, R.D.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CYTOCHROME B5' 10829.908 1 ? F35Y ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKYLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH PDDRSKIAKPSETL ; _entity_poly.pdbx_seq_one_letter_code_can ;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKYLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH PDDRSKIAKPSETL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING FE' _pdbx_entity_nonpoly.comp_id HEM # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 LYS n 1 3 ASP n 1 4 VAL n 1 5 LYS n 1 6 TYR n 1 7 TYR n 1 8 THR n 1 9 LEU n 1 10 GLU n 1 11 GLU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 HIS n 1 16 LYS n 1 17 ASP n 1 18 SER n 1 19 LYS n 1 20 SER n 1 21 THR n 1 22 TRP n 1 23 VAL n 1 24 ILE n 1 25 LEU n 1 26 HIS n 1 27 HIS n 1 28 LYS n 1 29 VAL n 1 30 TYR n 1 31 ASP n 1 32 LEU n 1 33 THR n 1 34 LYS n 1 35 TYR n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 HIS n 1 40 PRO n 1 41 GLY n 1 42 GLY n 1 43 GLU n 1 44 GLU n 1 45 VAL n 1 46 LEU n 1 47 ARG n 1 48 GLU n 1 49 GLN n 1 50 ALA n 1 51 GLY n 1 52 GLY n 1 53 ASP n 1 54 ALA n 1 55 THR n 1 56 GLU n 1 57 ASN n 1 58 PHE n 1 59 GLU n 1 60 ASP n 1 61 VAL n 1 62 GLY n 1 63 HIS n 1 64 SER n 1 65 THR n 1 66 ASP n 1 67 ALA n 1 68 ARG n 1 69 GLU n 1 70 LEU n 1 71 SER n 1 72 LYS n 1 73 THR n 1 74 TYR n 1 75 ILE n 1 76 ILE n 1 77 GLY n 1 78 GLU n 1 79 LEU n 1 80 HIS n 1 81 PRO n 1 82 ASP n 1 83 ASP n 1 84 ARG n 1 85 SER n 1 86 LYS n 1 87 ILE n 1 88 ALA n 1 89 LYS n 1 90 PRO n 1 91 SER n 1 92 GLU n 1 93 THR n 1 94 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'black rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus rattus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10117 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET3C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 ? ? ? A . n A 1 90 PRO 90 90 ? ? ? A . n A 1 91 SER 91 91 ? ? ? A . n A 1 92 GLU 92 92 ? ? ? A . n A 1 93 THR 93 93 ? ? ? A . n A 1 94 LEU 94 94 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id HEM _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 95 _pdbx_nonpoly_scheme.auth_seq_num 95 _pdbx_nonpoly_scheme.pdb_mon_id HEM _pdbx_nonpoly_scheme.auth_mon_id HEM _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 1IB7 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1IB7 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1IB7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1IB7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1IB7 _struct.title 'SOLUTION STRUCTURE OF F35Y MUTANT OF RAT FERRO CYTOCHROME B5, A CONFORMATION, ENSEMBLE OF 20 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IB7 _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'CYTOCHROME B5, ELECTRON TRANSPORT, SOLUTION STRUCTURES' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYB5_RAT _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P00173 _struct_ref.pdbx_align_begin 5 _struct_ref.pdbx_seq_one_letter_code ;DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTYIIGELH PDDRSKIAKPSETL ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IB7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 94 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00173 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 94 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1IB7 _struct_ref_seq_dif.mon_id TYR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 35 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00173 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 39 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 35 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 8 ? HIS A 15 ? THR A 8 HIS A 15 1 ? 8 HELX_P HELX_P2 2 GLU A 43 ? GLU A 48 ? GLU A 43 GLU A 48 1 ? 6 HELX_P HELX_P3 3 ALA A 54 ? ASP A 60 ? ALA A 54 ASP A 60 1 ? 7 HELX_P HELX_P4 4 SER A 64 ? TYR A 74 ? SER A 64 TYR A 74 1 ? 11 HELX_P HELX_P5 5 HIS A 80 ? SER A 85 ? HIS A 80 SER A 85 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 39 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 39 A HEM 95 1_555 ? ? ? ? ? ? ? 2.095 ? ? metalc2 metalc ? ? A HIS 63 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 63 A HEM 95 1_555 ? ? ? ? ? ? ? 1.892 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NA ? B HEM . ? A HEM 95 ? 1_555 89.4 ? 2 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 96.9 ? 3 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NB ? B HEM . ? A HEM 95 ? 1_555 90.8 ? 4 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 89.9 ? 5 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 179.1 ? 6 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NC ? B HEM . ? A HEM 95 ? 1_555 89.8 ? 7 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 82.7 ? 8 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 89.7 ? 9 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 179.3 ? 10 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 ND ? B HEM . ? A HEM 95 ? 1_555 89.7 ? 11 NE2 ? A HIS 39 ? A HIS 39 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 172.9 ? 12 NA ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 97.7 ? 13 NB ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 83.5 ? 14 NC ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 83.0 ? 15 ND ? B HEM . ? A HEM 95 ? 1_555 FE ? B HEM . ? A HEM 95 ? 1_555 NE2 ? A HIS 63 ? A HIS 63 ? 1_555 96.9 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 6 ? TYR A 7 ? TYR A 6 TYR A 7 A 2 ILE A 75 ? LEU A 79 ? ILE A 75 LEU A 79 A 3 VAL A 29 ? TYR A 30 ? VAL A 29 TYR A 30 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 7 ? N TYR A 7 O GLU A 78 ? O GLU A 78 A 2 3 O GLY A 77 ? O GLY A 77 N VAL A 29 ? N VAL A 29 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEM _struct_site.pdbx_auth_seq_id 95 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 16 _struct_site.details 'BINDING SITE FOR RESIDUE HEM A 95' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 16 TYR A 30 ? TYR A 30 . ? 1_555 ? 2 AC1 16 LEU A 32 ? LEU A 32 . ? 1_555 ? 3 AC1 16 TYR A 35 ? TYR A 35 . ? 1_555 ? 4 AC1 16 HIS A 39 ? HIS A 39 . ? 1_555 ? 5 AC1 16 VAL A 45 ? VAL A 45 . ? 1_555 ? 6 AC1 16 LEU A 46 ? LEU A 46 . ? 1_555 ? 7 AC1 16 ALA A 54 ? ALA A 54 . ? 1_555 ? 8 AC1 16 PHE A 58 ? PHE A 58 . ? 1_555 ? 9 AC1 16 VAL A 61 ? VAL A 61 . ? 1_555 ? 10 AC1 16 GLY A 62 ? GLY A 62 . ? 1_555 ? 11 AC1 16 HIS A 63 ? HIS A 63 . ? 1_555 ? 12 AC1 16 SER A 64 ? SER A 64 . ? 1_555 ? 13 AC1 16 ASP A 66 ? ASP A 66 . ? 1_555 ? 14 AC1 16 ALA A 67 ? ALA A 67 . ? 1_555 ? 15 AC1 16 LEU A 70 ? LEU A 70 . ? 1_555 ? 16 AC1 16 SER A 71 ? SER A 71 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A TYR 7 ? ? H A HIS 80 ? ? 1.54 2 1 O A GLU 56 ? ? H A ASP 60 ? ? 1.56 3 1 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 4 2 O A GLU 56 ? ? H A ASP 60 ? ? 1.53 5 2 O A TYR 7 ? ? H A HIS 80 ? ? 1.53 6 2 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 7 3 O A GLU 56 ? ? H A ASP 60 ? ? 1.48 8 3 HD1 A HIS 80 ? ? OD2 A ASP 83 ? ? 1.49 9 3 O A GLU 44 ? ? H A GLU 48 ? ? 1.50 10 3 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 11 3 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 12 4 O A TYR 7 ? ? H A HIS 80 ? ? 1.50 13 4 O A GLU 56 ? ? H A ASP 60 ? ? 1.53 14 4 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 15 5 O A TYR 7 ? ? H A HIS 80 ? ? 1.46 16 5 O A GLU 56 ? ? H A ASP 60 ? ? 1.53 17 5 O A THR 8 ? ? H A GLU 11 ? ? 1.53 18 5 O A GLU 11 ? ? H A HIS 15 ? ? 1.59 19 6 O A TYR 7 ? ? H A HIS 80 ? ? 1.47 20 6 O A GLU 56 ? ? H A ASP 60 ? ? 1.52 21 6 HD1 A HIS 80 ? ? OD1 A ASP 83 ? ? 1.58 22 6 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 23 7 O A TYR 7 ? ? H A HIS 80 ? ? 1.52 24 7 O A GLU 56 ? ? H A ASP 60 ? ? 1.54 25 7 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 26 8 O A GLU 56 ? ? H A ASP 60 ? ? 1.47 27 8 O A TYR 7 ? ? H A HIS 80 ? ? 1.52 28 8 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 29 9 O A TYR 7 ? ? H A HIS 80 ? ? 1.47 30 9 O A GLU 56 ? ? H A ASP 60 ? ? 1.58 31 9 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 32 10 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 33 10 O A GLU 56 ? ? H A ASP 60 ? ? 1.53 34 10 O A ALA 67 ? ? HG A SER 71 ? ? 1.57 35 10 O A THR 8 ? ? H A GLU 11 ? ? 1.58 36 11 O A GLU 56 ? ? H A ASP 60 ? ? 1.50 37 11 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 38 11 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 39 12 O A TYR 7 ? ? H A HIS 80 ? ? 1.49 40 12 O A GLU 56 ? ? H A ASP 60 ? ? 1.54 41 12 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 42 12 O A GLU 11 ? ? H A HIS 15 ? ? 1.59 43 13 O A GLU 56 ? ? H A ASP 60 ? ? 1.52 44 13 O A LEU 70 ? ? H A TYR 74 ? ? 1.60 45 14 H A LEU 25 ? ? O A LYS 28 ? ? 1.44 46 14 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 47 14 O A GLU 56 ? ? H A ASP 60 ? ? 1.55 48 14 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 49 14 O A THR 8 ? ? H A GLU 11 ? ? 1.59 50 15 O A GLU 56 ? ? H A ASP 60 ? ? 1.41 51 15 OD2 A ASP 31 ? ? HZ3 A LYS 34 ? ? 1.55 52 15 O A TYR 7 ? ? H A HIS 80 ? ? 1.58 53 15 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 54 16 O A GLU 56 ? ? H A ASP 60 ? ? 1.49 55 16 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 56 16 O A LEU 70 ? ? H A TYR 74 ? ? 1.59 57 17 O A TYR 7 ? ? H A HIS 80 ? ? 1.52 58 17 O A GLU 56 ? ? H A ASP 60 ? ? 1.52 59 17 O A LEU 70 ? ? H A TYR 74 ? ? 1.58 60 18 O A GLU 56 ? ? H A ASP 60 ? ? 1.49 61 18 H A LEU 25 ? ? O A LYS 28 ? ? 1.50 62 18 O A TYR 7 ? ? H A HIS 80 ? ? 1.51 63 18 O A LEU 70 ? ? H A TYR 74 ? ? 1.56 64 19 H A LEU 25 ? ? O A LYS 28 ? ? 1.48 65 19 O A GLU 56 ? ? H A ASP 60 ? ? 1.55 66 19 O A TYR 7 ? ? H A HIS 80 ? ? 1.57 67 19 O A LEU 70 ? ? H A TYR 74 ? ? 1.60 68 20 H A LEU 25 ? ? O A LYS 28 ? ? 1.46 69 20 O A TYR 7 ? ? H A HIS 80 ? ? 1.53 70 20 O A GLU 56 ? ? H A ASP 60 ? ? 1.55 71 20 HD1 A HIS 39 ? ? O A GLY 42 ? ? 1.56 72 20 O A ASP 17 ? ? HG1 A THR 21 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 11 ? ? -61.64 -75.75 2 1 GLN A 13 ? ? -55.00 -73.50 3 1 HIS A 15 ? ? -96.70 45.88 4 1 HIS A 26 ? ? 39.90 61.44 5 1 LYS A 28 ? ? -169.96 113.20 6 1 LEU A 32 ? ? -93.91 39.66 7 1 ALA A 50 ? ? -70.13 -92.11 8 1 HIS A 80 ? ? -38.68 108.66 9 1 SER A 85 ? ? -90.85 45.77 10 2 GLU A 11 ? ? -61.61 -74.61 11 2 GLN A 13 ? ? -61.80 -82.76 12 2 HIS A 15 ? ? -91.29 48.31 13 2 HIS A 26 ? ? 39.73 53.74 14 2 LYS A 28 ? ? -169.95 106.33 15 2 LEU A 32 ? ? -95.34 36.29 16 2 ALA A 50 ? ? -71.99 -90.11 17 2 THR A 55 ? ? -50.43 -72.10 18 2 TYR A 74 ? ? -100.04 41.61 19 2 HIS A 80 ? ? -38.52 120.05 20 2 SER A 85 ? ? -109.37 45.64 21 3 GLU A 11 ? ? -61.71 -72.72 22 3 GLN A 13 ? ? -59.40 -78.84 23 3 HIS A 15 ? ? -93.55 43.67 24 3 HIS A 26 ? ? 38.99 55.57 25 3 LYS A 28 ? ? -168.91 99.32 26 3 LEU A 32 ? ? -92.71 44.95 27 3 GLU A 48 ? ? -35.97 -36.43 28 3 GLN A 49 ? ? -143.24 45.84 29 3 ALA A 50 ? ? -65.48 -87.11 30 3 TYR A 74 ? ? -100.00 37.94 31 3 HIS A 80 ? ? -37.84 115.05 32 3 LYS A 86 ? ? -99.65 30.76 33 4 GLU A 11 ? ? -58.63 -73.53 34 4 GLN A 13 ? ? -55.96 -78.97 35 4 HIS A 15 ? ? -94.13 43.80 36 4 HIS A 26 ? ? 38.83 60.31 37 4 LYS A 28 ? ? -169.56 107.07 38 4 LEU A 32 ? ? -90.81 38.51 39 4 VAL A 45 ? ? -39.86 -29.45 40 4 ALA A 50 ? ? -68.50 -89.30 41 4 LYS A 86 ? ? -92.59 35.36 42 5 GLU A 11 ? ? -62.45 -75.66 43 5 GLN A 13 ? ? -59.85 -70.42 44 5 HIS A 15 ? ? -89.76 46.98 45 5 LYS A 28 ? ? -170.04 106.20 46 5 LEU A 32 ? ? -92.54 40.15 47 5 VAL A 45 ? ? -39.98 -29.18 48 5 ALA A 50 ? ? -70.74 -91.54 49 5 SER A 85 ? ? -93.18 46.99 50 6 GLU A 11 ? ? -60.09 -75.70 51 6 HIS A 15 ? ? -94.62 44.38 52 6 HIS A 26 ? ? 39.67 43.83 53 6 LYS A 28 ? ? -166.03 115.71 54 6 ALA A 50 ? ? -77.39 -90.49 55 6 TYR A 74 ? ? -99.47 40.65 56 6 HIS A 80 ? ? -39.04 118.57 57 6 LYS A 86 ? ? -98.13 38.61 58 7 GLU A 11 ? ? -66.18 -75.29 59 7 GLN A 13 ? ? -57.71 -73.66 60 7 HIS A 15 ? ? -92.23 49.99 61 7 HIS A 26 ? ? 39.81 55.91 62 7 LYS A 28 ? ? -167.65 101.71 63 7 LEU A 32 ? ? -89.45 42.83 64 7 VAL A 45 ? ? -39.94 -29.49 65 7 ALA A 50 ? ? -73.01 -91.16 66 7 THR A 55 ? ? -50.04 -72.06 67 7 HIS A 80 ? ? -38.42 103.12 68 8 GLU A 11 ? ? -57.77 -74.12 69 8 HIS A 15 ? ? -99.56 43.39 70 8 HIS A 26 ? ? 39.70 53.83 71 8 LYS A 28 ? ? -169.40 109.22 72 8 LEU A 32 ? ? -89.78 42.66 73 8 VAL A 45 ? ? -39.97 -29.24 74 8 ALA A 50 ? ? -70.90 -93.10 75 8 TYR A 74 ? ? -99.85 39.04 76 8 HIS A 80 ? ? -38.75 112.83 77 9 GLU A 11 ? ? -54.93 -73.38 78 9 HIS A 26 ? ? 39.20 60.53 79 9 LYS A 28 ? ? -169.41 100.62 80 9 LEU A 32 ? ? -98.68 54.22 81 9 VAL A 45 ? ? -39.97 -29.14 82 9 ALA A 50 ? ? -67.31 -93.97 83 9 HIS A 80 ? ? -37.39 117.78 84 9 SER A 85 ? ? -103.36 43.38 85 9 LYS A 86 ? ? -99.72 36.33 86 10 GLU A 11 ? ? -67.32 -75.05 87 10 GLN A 13 ? ? -57.21 -77.65 88 10 HIS A 15 ? ? -94.22 44.53 89 10 HIS A 26 ? ? 37.64 36.32 90 10 HIS A 27 ? ? 70.00 48.20 91 10 LYS A 28 ? ? -170.18 127.17 92 10 ASP A 31 ? ? -64.73 78.88 93 10 LEU A 32 ? ? -102.33 41.68 94 10 ALA A 50 ? ? -73.87 -91.01 95 10 SER A 85 ? ? -107.55 53.65 96 11 GLU A 11 ? ? -59.32 -71.20 97 11 GLN A 13 ? ? -54.82 -81.27 98 11 HIS A 15 ? ? -95.13 45.49 99 11 HIS A 26 ? ? 39.97 54.40 100 11 LYS A 28 ? ? -170.01 103.13 101 11 LEU A 32 ? ? -99.42 43.17 102 11 VAL A 45 ? ? -39.88 -28.98 103 11 ALA A 50 ? ? -74.37 -91.32 104 11 TYR A 74 ? ? -99.86 41.81 105 11 SER A 85 ? ? -109.78 46.21 106 11 LYS A 86 ? ? -98.70 33.95 107 12 GLN A 13 ? ? -48.44 -76.73 108 12 HIS A 15 ? ? -90.42 44.40 109 12 HIS A 26 ? ? 39.17 56.48 110 12 LYS A 28 ? ? -170.08 105.02 111 12 LEU A 32 ? ? -96.80 41.98 112 12 VAL A 45 ? ? -39.84 -29.68 113 12 ALA A 50 ? ? -72.83 -89.47 114 12 TYR A 74 ? ? -100.04 42.04 115 13 GLU A 11 ? ? -59.74 -72.33 116 13 GLN A 13 ? ? -59.93 -76.40 117 13 HIS A 15 ? ? -97.60 44.83 118 13 LYS A 28 ? ? -170.09 112.63 119 13 LEU A 32 ? ? -90.99 37.87 120 13 ALA A 50 ? ? -70.27 -93.24 121 13 HIS A 80 ? ? -32.41 105.28 122 13 SER A 85 ? ? -107.62 -99.79 123 14 GLU A 11 ? ? -61.78 -76.12 124 14 GLN A 13 ? ? -57.01 -74.00 125 14 HIS A 15 ? ? -93.26 46.78 126 14 HIS A 26 ? ? 37.72 38.25 127 14 HIS A 27 ? ? 70.13 51.51 128 14 LYS A 28 ? ? -170.12 132.09 129 14 VAL A 45 ? ? -39.93 -29.17 130 14 ALA A 50 ? ? -73.01 -88.63 131 14 TYR A 74 ? ? -99.95 39.90 132 14 HIS A 80 ? ? -39.40 111.69 133 14 SER A 85 ? ? -97.42 31.84 134 15 HIS A 15 ? ? -94.36 59.61 135 15 LYS A 28 ? ? -166.01 107.74 136 15 LEU A 32 ? ? -98.24 46.59 137 15 VAL A 45 ? ? -39.87 -29.32 138 15 ALA A 50 ? ? -67.99 -91.47 139 15 THR A 55 ? ? -50.15 -71.54 140 15 TYR A 74 ? ? -100.12 41.02 141 15 HIS A 80 ? ? -38.66 113.46 142 15 SER A 85 ? ? -100.64 50.36 143 16 GLU A 11 ? ? -49.62 -70.55 144 16 LYS A 28 ? ? -170.09 97.70 145 16 LEU A 32 ? ? -91.34 41.64 146 16 VAL A 45 ? ? -39.90 -29.57 147 16 ALA A 50 ? ? -71.72 -94.49 148 16 TYR A 74 ? ? -99.81 42.04 149 16 HIS A 80 ? ? -36.32 110.65 150 16 LYS A 86 ? ? -95.66 38.51 151 17 GLU A 11 ? ? -48.73 -71.02 152 17 HIS A 15 ? ? -91.77 59.45 153 17 HIS A 26 ? ? 37.98 54.34 154 17 LYS A 28 ? ? -169.97 110.20 155 17 LEU A 32 ? ? -94.74 43.17 156 17 ALA A 50 ? ? -69.41 -94.97 157 17 TYR A 74 ? ? -100.17 42.36 158 17 HIS A 80 ? ? -46.19 107.41 159 17 SER A 85 ? ? -109.99 44.34 160 17 LYS A 86 ? ? -90.90 37.10 161 18 GLU A 11 ? ? -59.89 -77.35 162 18 HIS A 15 ? ? -104.24 47.87 163 18 HIS A 26 ? ? 36.46 40.60 164 18 LYS A 28 ? ? -170.19 126.48 165 18 LEU A 32 ? ? -94.60 37.74 166 18 VAL A 45 ? ? -39.99 -28.99 167 18 ALA A 50 ? ? -67.07 -91.48 168 18 HIS A 80 ? ? -36.90 105.19 169 19 HIS A 26 ? ? 37.27 39.90 170 19 LYS A 28 ? ? -170.03 127.45 171 19 LEU A 32 ? ? -95.85 39.21 172 19 ALA A 50 ? ? -73.01 -91.23 173 19 TYR A 74 ? ? -99.64 38.78 174 19 HIS A 80 ? ? -38.60 109.89 175 19 SER A 85 ? ? -108.74 54.70 176 20 GLU A 11 ? ? -49.04 -71.35 177 20 HIS A 15 ? ? -90.98 55.07 178 20 HIS A 26 ? ? 36.82 39.76 179 20 LYS A 28 ? ? -170.15 131.29 180 20 VAL A 45 ? ? -39.89 -29.20 181 20 ALA A 50 ? ? -71.79 -92.31 182 20 TYR A 74 ? ? -99.63 39.87 183 20 HIS A 80 ? ? -40.19 104.53 184 20 LYS A 86 ? ? -92.75 36.83 # _pdbx_nmr_ensemble.entry_id 1IB7 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1IB7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations,lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;2mM F35Y CYTOCHROME B5; 1mM PHOSPHATE BUFFER; PURGED WITH NITROGEN GAS AND REDUCED BY ADDING FEW GRAINS OF SODIUM DITHIONATE AND SEALED USING OXY-ACETYLENE TORCH; 0.05 mM TSP AS INTERNAL REFERENCE ; '90% H2O/10% D2O' 2 ;2mM F35Y CYTOCHROME B5; 1mM PHOSPHATE BUFFER; PURGED WITH NITROGEN GAS AND REDUCED BY ADDING FEW GRAINS OF SODIUM DITHIONATE AND SEALED USING OXY-ACETYLENE TORCH; 0.05 mM TSP AS INTERNAL REFERENCE ; '90% H2O/10% D2O' 3 ;2mM F35Y CYTOCHROME B5; 1mM PHOSPHATE BUFFER; PURGED WITH NITROGEN GAS AND REDUCED BY ADDING FEW GRAINS OF SODIUM DITHIONATE AND SEALED USING OXY-ACETYLENE TORCH; 0.05 mM TSP AS INTERNAL REFERENCE ; '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 313 ? 7.0 1mM ? K 2 313 ? 7.0 1mM ? K 3 313 ? 7.0 1mM ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 2 2 HNHA 3 3 3 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1IB7 _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING 2D AND 3D EXPERIMENTS INCLUDING DISTANCE AND ANGULAR RESTRAINTS FROM HNHA' # _pdbx_nmr_refine.entry_id 1IB7 _pdbx_nmr_refine.method 'TORSION ANGEL DYNAMICS SIMULATED ANNEALING; RESTRAINED ENERGY' _pdbx_nmr_refine.details ;THE STRUCTURE WAS CALCULATED USING 1167 NOE RESTRAINTS AND 69 DIHEDRAL ANGLE RESTRAINTS; RESIDUES 1-3 AND 89-94 WERE NOT INCLUDED IN THE REFINED MODEL BECAUSE OF A LACK OF RESTRAINTS IN THESE PRESUMABLY UNSTRUCTURED REGIONS OF THE PROTEIN. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 refinement 'GUENTERT, P.' 1 Felix 97 'data analysis' MSI 2 XwinNMR 2.0 collection BRUKER 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 1 ? A ASP 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A LYS 89 ? A LYS 89 5 1 Y 1 A PRO 90 ? A PRO 90 6 1 Y 1 A SER 91 ? A SER 91 7 1 Y 1 A GLU 92 ? A GLU 92 8 1 Y 1 A THR 93 ? A THR 93 9 1 Y 1 A LEU 94 ? A LEU 94 10 2 Y 1 A ASP 1 ? A ASP 1 11 2 Y 1 A LYS 2 ? A LYS 2 12 2 Y 1 A ASP 3 ? A ASP 3 13 2 Y 1 A LYS 89 ? A LYS 89 14 2 Y 1 A PRO 90 ? A PRO 90 15 2 Y 1 A SER 91 ? A SER 91 16 2 Y 1 A GLU 92 ? A GLU 92 17 2 Y 1 A THR 93 ? A THR 93 18 2 Y 1 A LEU 94 ? A LEU 94 19 3 Y 1 A ASP 1 ? A ASP 1 20 3 Y 1 A LYS 2 ? A LYS 2 21 3 Y 1 A ASP 3 ? A ASP 3 22 3 Y 1 A LYS 89 ? A LYS 89 23 3 Y 1 A PRO 90 ? A PRO 90 24 3 Y 1 A SER 91 ? A SER 91 25 3 Y 1 A GLU 92 ? A GLU 92 26 3 Y 1 A THR 93 ? A THR 93 27 3 Y 1 A LEU 94 ? A LEU 94 28 4 Y 1 A ASP 1 ? A ASP 1 29 4 Y 1 A LYS 2 ? A LYS 2 30 4 Y 1 A ASP 3 ? A ASP 3 31 4 Y 1 A LYS 89 ? A LYS 89 32 4 Y 1 A PRO 90 ? A PRO 90 33 4 Y 1 A SER 91 ? A SER 91 34 4 Y 1 A GLU 92 ? A GLU 92 35 4 Y 1 A THR 93 ? A THR 93 36 4 Y 1 A LEU 94 ? A LEU 94 37 5 Y 1 A ASP 1 ? A ASP 1 38 5 Y 1 A LYS 2 ? A LYS 2 39 5 Y 1 A ASP 3 ? A ASP 3 40 5 Y 1 A LYS 89 ? A LYS 89 41 5 Y 1 A PRO 90 ? A PRO 90 42 5 Y 1 A SER 91 ? A SER 91 43 5 Y 1 A GLU 92 ? A GLU 92 44 5 Y 1 A THR 93 ? A THR 93 45 5 Y 1 A LEU 94 ? A LEU 94 46 6 Y 1 A ASP 1 ? A ASP 1 47 6 Y 1 A LYS 2 ? A LYS 2 48 6 Y 1 A ASP 3 ? A ASP 3 49 6 Y 1 A LYS 89 ? A LYS 89 50 6 Y 1 A PRO 90 ? A PRO 90 51 6 Y 1 A SER 91 ? A SER 91 52 6 Y 1 A GLU 92 ? A GLU 92 53 6 Y 1 A THR 93 ? A THR 93 54 6 Y 1 A LEU 94 ? A LEU 94 55 7 Y 1 A ASP 1 ? A ASP 1 56 7 Y 1 A LYS 2 ? A LYS 2 57 7 Y 1 A ASP 3 ? A ASP 3 58 7 Y 1 A LYS 89 ? A LYS 89 59 7 Y 1 A PRO 90 ? A PRO 90 60 7 Y 1 A SER 91 ? A SER 91 61 7 Y 1 A GLU 92 ? A GLU 92 62 7 Y 1 A THR 93 ? A THR 93 63 7 Y 1 A LEU 94 ? A LEU 94 64 8 Y 1 A ASP 1 ? A ASP 1 65 8 Y 1 A LYS 2 ? A LYS 2 66 8 Y 1 A ASP 3 ? A ASP 3 67 8 Y 1 A LYS 89 ? A LYS 89 68 8 Y 1 A PRO 90 ? A PRO 90 69 8 Y 1 A SER 91 ? A SER 91 70 8 Y 1 A GLU 92 ? A GLU 92 71 8 Y 1 A THR 93 ? A THR 93 72 8 Y 1 A LEU 94 ? A LEU 94 73 9 Y 1 A ASP 1 ? A ASP 1 74 9 Y 1 A LYS 2 ? A LYS 2 75 9 Y 1 A ASP 3 ? A ASP 3 76 9 Y 1 A LYS 89 ? A LYS 89 77 9 Y 1 A PRO 90 ? A PRO 90 78 9 Y 1 A SER 91 ? A SER 91 79 9 Y 1 A GLU 92 ? A GLU 92 80 9 Y 1 A THR 93 ? A THR 93 81 9 Y 1 A LEU 94 ? A LEU 94 82 10 Y 1 A ASP 1 ? A ASP 1 83 10 Y 1 A LYS 2 ? A LYS 2 84 10 Y 1 A ASP 3 ? A ASP 3 85 10 Y 1 A LYS 89 ? A LYS 89 86 10 Y 1 A PRO 90 ? A PRO 90 87 10 Y 1 A SER 91 ? A SER 91 88 10 Y 1 A GLU 92 ? A GLU 92 89 10 Y 1 A THR 93 ? A THR 93 90 10 Y 1 A LEU 94 ? A LEU 94 91 11 Y 1 A ASP 1 ? A ASP 1 92 11 Y 1 A LYS 2 ? A LYS 2 93 11 Y 1 A ASP 3 ? A ASP 3 94 11 Y 1 A LYS 89 ? A LYS 89 95 11 Y 1 A PRO 90 ? A PRO 90 96 11 Y 1 A SER 91 ? A SER 91 97 11 Y 1 A GLU 92 ? A GLU 92 98 11 Y 1 A THR 93 ? A THR 93 99 11 Y 1 A LEU 94 ? A LEU 94 100 12 Y 1 A ASP 1 ? A ASP 1 101 12 Y 1 A LYS 2 ? A LYS 2 102 12 Y 1 A ASP 3 ? A ASP 3 103 12 Y 1 A LYS 89 ? A LYS 89 104 12 Y 1 A PRO 90 ? A PRO 90 105 12 Y 1 A SER 91 ? A SER 91 106 12 Y 1 A GLU 92 ? A GLU 92 107 12 Y 1 A THR 93 ? A THR 93 108 12 Y 1 A LEU 94 ? A LEU 94 109 13 Y 1 A ASP 1 ? A ASP 1 110 13 Y 1 A LYS 2 ? A LYS 2 111 13 Y 1 A ASP 3 ? A ASP 3 112 13 Y 1 A LYS 89 ? A LYS 89 113 13 Y 1 A PRO 90 ? A PRO 90 114 13 Y 1 A SER 91 ? A SER 91 115 13 Y 1 A GLU 92 ? A GLU 92 116 13 Y 1 A THR 93 ? A THR 93 117 13 Y 1 A LEU 94 ? A LEU 94 118 14 Y 1 A ASP 1 ? A ASP 1 119 14 Y 1 A LYS 2 ? A LYS 2 120 14 Y 1 A ASP 3 ? A ASP 3 121 14 Y 1 A LYS 89 ? A LYS 89 122 14 Y 1 A PRO 90 ? A PRO 90 123 14 Y 1 A SER 91 ? A SER 91 124 14 Y 1 A GLU 92 ? A GLU 92 125 14 Y 1 A THR 93 ? A THR 93 126 14 Y 1 A LEU 94 ? A LEU 94 127 15 Y 1 A ASP 1 ? A ASP 1 128 15 Y 1 A LYS 2 ? A LYS 2 129 15 Y 1 A ASP 3 ? A ASP 3 130 15 Y 1 A LYS 89 ? A LYS 89 131 15 Y 1 A PRO 90 ? A PRO 90 132 15 Y 1 A SER 91 ? A SER 91 133 15 Y 1 A GLU 92 ? A GLU 92 134 15 Y 1 A THR 93 ? A THR 93 135 15 Y 1 A LEU 94 ? A LEU 94 136 16 Y 1 A ASP 1 ? A ASP 1 137 16 Y 1 A LYS 2 ? A LYS 2 138 16 Y 1 A ASP 3 ? A ASP 3 139 16 Y 1 A LYS 89 ? A LYS 89 140 16 Y 1 A PRO 90 ? A PRO 90 141 16 Y 1 A SER 91 ? A SER 91 142 16 Y 1 A GLU 92 ? A GLU 92 143 16 Y 1 A THR 93 ? A THR 93 144 16 Y 1 A LEU 94 ? A LEU 94 145 17 Y 1 A ASP 1 ? A ASP 1 146 17 Y 1 A LYS 2 ? A LYS 2 147 17 Y 1 A ASP 3 ? A ASP 3 148 17 Y 1 A LYS 89 ? A LYS 89 149 17 Y 1 A PRO 90 ? A PRO 90 150 17 Y 1 A SER 91 ? A SER 91 151 17 Y 1 A GLU 92 ? A GLU 92 152 17 Y 1 A THR 93 ? A THR 93 153 17 Y 1 A LEU 94 ? A LEU 94 154 18 Y 1 A ASP 1 ? A ASP 1 155 18 Y 1 A LYS 2 ? A LYS 2 156 18 Y 1 A ASP 3 ? A ASP 3 157 18 Y 1 A LYS 89 ? A LYS 89 158 18 Y 1 A PRO 90 ? A PRO 90 159 18 Y 1 A SER 91 ? A SER 91 160 18 Y 1 A GLU 92 ? A GLU 92 161 18 Y 1 A THR 93 ? A THR 93 162 18 Y 1 A LEU 94 ? A LEU 94 163 19 Y 1 A ASP 1 ? A ASP 1 164 19 Y 1 A LYS 2 ? A LYS 2 165 19 Y 1 A ASP 3 ? A ASP 3 166 19 Y 1 A LYS 89 ? A LYS 89 167 19 Y 1 A PRO 90 ? A PRO 90 168 19 Y 1 A SER 91 ? A SER 91 169 19 Y 1 A GLU 92 ? A GLU 92 170 19 Y 1 A THR 93 ? A THR 93 171 19 Y 1 A LEU 94 ? A LEU 94 172 20 Y 1 A ASP 1 ? A ASP 1 173 20 Y 1 A LYS 2 ? A LYS 2 174 20 Y 1 A ASP 3 ? A ASP 3 175 20 Y 1 A LYS 89 ? A LYS 89 176 20 Y 1 A PRO 90 ? A PRO 90 177 20 Y 1 A SER 91 ? A SER 91 178 20 Y 1 A GLU 92 ? A GLU 92 179 20 Y 1 A THR 93 ? A THR 93 180 20 Y 1 A LEU 94 ? A LEU 94 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HEM CHA C N N 123 HEM CHB C N N 124 HEM CHC C N N 125 HEM CHD C N N 126 HEM C1A C Y N 127 HEM C2A C Y N 128 HEM C3A C Y N 129 HEM C4A C Y N 130 HEM CMA C N N 131 HEM CAA C N N 132 HEM CBA C N N 133 HEM CGA C N N 134 HEM O1A O N N 135 HEM O2A O N N 136 HEM C1B C N N 137 HEM C2B C N N 138 HEM C3B C N N 139 HEM C4B C N N 140 HEM CMB C N N 141 HEM CAB C N N 142 HEM CBB C N N 143 HEM C1C C Y N 144 HEM C2C C Y N 145 HEM C3C C Y N 146 HEM C4C C Y N 147 HEM CMC C N N 148 HEM CAC C N N 149 HEM CBC C N N 150 HEM C1D C N N 151 HEM C2D C N N 152 HEM C3D C N N 153 HEM C4D C N N 154 HEM CMD C N N 155 HEM CAD C N N 156 HEM CBD C N N 157 HEM CGD C N N 158 HEM O1D O N N 159 HEM O2D O N N 160 HEM NA N Y N 161 HEM NB N N N 162 HEM NC N Y N 163 HEM ND N N N 164 HEM FE FE N N 165 HEM HHB H N N 166 HEM HHC H N N 167 HEM HHD H N N 168 HEM HMA H N N 169 HEM HMAA H N N 170 HEM HMAB H N N 171 HEM HAA H N N 172 HEM HAAA H N N 173 HEM HBA H N N 174 HEM HBAA H N N 175 HEM HMB H N N 176 HEM HMBA H N N 177 HEM HMBB H N N 178 HEM HAB H N N 179 HEM HBB H N N 180 HEM HBBA H N N 181 HEM HMC H N N 182 HEM HMCA H N N 183 HEM HMCB H N N 184 HEM HAC H N N 185 HEM HBC H N N 186 HEM HBCA H N N 187 HEM HMD H N N 188 HEM HMDA H N N 189 HEM HMDB H N N 190 HEM HAD H N N 191 HEM HADA H N N 192 HEM HBD H N N 193 HEM HBDA H N N 194 HEM H2A H N N 195 HEM H2D H N N 196 HEM HHA H N N 197 HIS N N N N 198 HIS CA C N S 199 HIS C C N N 200 HIS O O N N 201 HIS CB C N N 202 HIS CG C Y N 203 HIS ND1 N Y N 204 HIS CD2 C Y N 205 HIS CE1 C Y N 206 HIS NE2 N Y N 207 HIS OXT O N N 208 HIS H H N N 209 HIS H2 H N N 210 HIS HA H N N 211 HIS HB2 H N N 212 HIS HB3 H N N 213 HIS HD1 H N N 214 HIS HD2 H N N 215 HIS HE1 H N N 216 HIS HE2 H N N 217 HIS HXT H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 PHE N N N N 288 PHE CA C N S 289 PHE C C N N 290 PHE O O N N 291 PHE CB C N N 292 PHE CG C Y N 293 PHE CD1 C Y N 294 PHE CD2 C Y N 295 PHE CE1 C Y N 296 PHE CE2 C Y N 297 PHE CZ C Y N 298 PHE OXT O N N 299 PHE H H N N 300 PHE H2 H N N 301 PHE HA H N N 302 PHE HB2 H N N 303 PHE HB3 H N N 304 PHE HD1 H N N 305 PHE HD2 H N N 306 PHE HE1 H N N 307 PHE HE2 H N N 308 PHE HZ H N N 309 PHE HXT H N N 310 PRO N N N N 311 PRO CA C N S 312 PRO C C N N 313 PRO O O N N 314 PRO CB C N N 315 PRO CG C N N 316 PRO CD C N N 317 PRO OXT O N N 318 PRO H H N N 319 PRO HA H N N 320 PRO HB2 H N N 321 PRO HB3 H N N 322 PRO HG2 H N N 323 PRO HG3 H N N 324 PRO HD2 H N N 325 PRO HD3 H N N 326 PRO HXT H N N 327 SER N N N N 328 SER CA C N S 329 SER C C N N 330 SER O O N N 331 SER CB C N N 332 SER OG O N N 333 SER OXT O N N 334 SER H H N N 335 SER H2 H N N 336 SER HA H N N 337 SER HB2 H N N 338 SER HB3 H N N 339 SER HG H N N 340 SER HXT H N N 341 THR N N N N 342 THR CA C N S 343 THR C C N N 344 THR O O N N 345 THR CB C N R 346 THR OG1 O N N 347 THR CG2 C N N 348 THR OXT O N N 349 THR H H N N 350 THR H2 H N N 351 THR HA H N N 352 THR HB H N N 353 THR HG1 H N N 354 THR HG21 H N N 355 THR HG22 H N N 356 THR HG23 H N N 357 THR HXT H N N 358 TRP N N N N 359 TRP CA C N S 360 TRP C C N N 361 TRP O O N N 362 TRP CB C N N 363 TRP CG C Y N 364 TRP CD1 C Y N 365 TRP CD2 C Y N 366 TRP NE1 N Y N 367 TRP CE2 C Y N 368 TRP CE3 C Y N 369 TRP CZ2 C Y N 370 TRP CZ3 C Y N 371 TRP CH2 C Y N 372 TRP OXT O N N 373 TRP H H N N 374 TRP H2 H N N 375 TRP HA H N N 376 TRP HB2 H N N 377 TRP HB3 H N N 378 TRP HD1 H N N 379 TRP HE1 H N N 380 TRP HE3 H N N 381 TRP HZ2 H N N 382 TRP HZ3 H N N 383 TRP HH2 H N N 384 TRP HXT H N N 385 TYR N N N N 386 TYR CA C N S 387 TYR C C N N 388 TYR O O N N 389 TYR CB C N N 390 TYR CG C Y N 391 TYR CD1 C Y N 392 TYR CD2 C Y N 393 TYR CE1 C Y N 394 TYR CE2 C Y N 395 TYR CZ C Y N 396 TYR OH O N N 397 TYR OXT O N N 398 TYR H H N N 399 TYR H2 H N N 400 TYR HA H N N 401 TYR HB2 H N N 402 TYR HB3 H N N 403 TYR HD1 H N N 404 TYR HD2 H N N 405 TYR HE1 H N N 406 TYR HE2 H N N 407 TYR HH H N N 408 TYR HXT H N N 409 VAL N N N N 410 VAL CA C N S 411 VAL C C N N 412 VAL O O N N 413 VAL CB C N N 414 VAL CG1 C N N 415 VAL CG2 C N N 416 VAL OXT O N N 417 VAL H H N N 418 VAL H2 H N N 419 VAL HA H N N 420 VAL HB H N N 421 VAL HG11 H N N 422 VAL HG12 H N N 423 VAL HG13 H N N 424 VAL HG21 H N N 425 VAL HG22 H N N 426 VAL HG23 H N N 427 VAL HXT H N N 428 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HEM CHA C1A sing N N 116 HEM CHA C4D doub N N 117 HEM CHA HHA sing N N 118 HEM CHB C4A sing N N 119 HEM CHB C1B doub N N 120 HEM CHB HHB sing N N 121 HEM CHC C4B sing N N 122 HEM CHC C1C doub N N 123 HEM CHC HHC sing N N 124 HEM CHD C4C doub N N 125 HEM CHD C1D sing N N 126 HEM CHD HHD sing N N 127 HEM C1A C2A doub Y N 128 HEM C1A NA sing Y N 129 HEM C2A C3A sing Y N 130 HEM C2A CAA sing N N 131 HEM C3A C4A doub Y N 132 HEM C3A CMA sing N N 133 HEM C4A NA sing Y N 134 HEM CMA HMA sing N N 135 HEM CMA HMAA sing N N 136 HEM CMA HMAB sing N N 137 HEM CAA CBA sing N N 138 HEM CAA HAA sing N N 139 HEM CAA HAAA sing N N 140 HEM CBA CGA sing N N 141 HEM CBA HBA sing N N 142 HEM CBA HBAA sing N N 143 HEM CGA O1A doub N N 144 HEM CGA O2A sing N N 145 HEM C1B C2B sing N N 146 HEM C1B NB sing N N 147 HEM C2B C3B doub N N 148 HEM C2B CMB sing N N 149 HEM C3B C4B sing N N 150 HEM C3B CAB sing N N 151 HEM C4B NB doub N N 152 HEM CMB HMB sing N N 153 HEM CMB HMBA sing N N 154 HEM CMB HMBB sing N N 155 HEM CAB CBB doub N N 156 HEM CAB HAB sing N N 157 HEM CBB HBB sing N N 158 HEM CBB HBBA sing N N 159 HEM C1C C2C sing Y N 160 HEM C1C NC sing Y N 161 HEM C2C C3C doub Y N 162 HEM C2C CMC sing N N 163 HEM C3C C4C sing Y N 164 HEM C3C CAC sing N N 165 HEM C4C NC sing Y N 166 HEM CMC HMC sing N N 167 HEM CMC HMCA sing N N 168 HEM CMC HMCB sing N N 169 HEM CAC CBC doub N N 170 HEM CAC HAC sing N N 171 HEM CBC HBC sing N N 172 HEM CBC HBCA sing N N 173 HEM C1D C2D sing N N 174 HEM C1D ND doub N N 175 HEM C2D C3D doub N N 176 HEM C2D CMD sing N N 177 HEM C3D C4D sing N N 178 HEM C3D CAD sing N N 179 HEM C4D ND sing N N 180 HEM CMD HMD sing N N 181 HEM CMD HMDA sing N N 182 HEM CMD HMDB sing N N 183 HEM CAD CBD sing N N 184 HEM CAD HAD sing N N 185 HEM CAD HADA sing N N 186 HEM CBD CGD sing N N 187 HEM CBD HBD sing N N 188 HEM CBD HBDA sing N N 189 HEM CGD O1D doub N N 190 HEM CGD O2D sing N N 191 HEM O2A H2A sing N N 192 HEM O2D H2D sing N N 193 HEM FE NA sing N N 194 HEM FE NB sing N N 195 HEM FE NC sing N N 196 HEM FE ND sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker DMX 600 3 ? Bruker DMX 600 # _atom_sites.entry_id 1IB7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O # loop_