data_1IYY # _entry.id 1IYY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1IYY pdb_00001iyy 10.2210/pdb1iyy/pdb RCSB RCSB005422 ? ? WWPDB D_1000005422 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-07 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-07-25 5 'Structure model' 1 4 2023-12-27 6 'Structure model' 1 5 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Structure summary' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' entity 3 4 'Structure model' entity_src_gen 4 4 'Structure model' entity_src_nat 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_assembly_prop 7 4 'Structure model' pdbx_struct_oper_list 8 4 'Structure model' struct_ref 9 4 'Structure model' struct_ref_seq 10 4 'Structure model' struct_ref_seq_dif 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' database_2 14 6 'Structure model' pdbx_entry_details 15 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.pdbx_database_id_PubMed' 3 4 'Structure model' '_citation.title' 4 4 'Structure model' '_entity.src_method' 5 4 'Structure model' '_struct_ref.db_code' 6 4 'Structure model' '_struct_ref.pdbx_db_accession' 7 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' 8 4 'Structure model' '_struct_ref_seq.pdbx_db_accession' 9 4 'Structure model' '_struct_ref_seq_dif.details' 10 4 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 11 5 'Structure model' '_database_2.pdbx_DOI' 12 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1IYY _pdbx_database_status.recvd_initial_deposition_date 2002-09-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1YGW _pdbx_database_related.details '1YGW contains NMR structure of the Isozyme, 34 structures' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hatano, K.' 1 'Kojima, M.' 2 'Suzuki, E.' 3 'Tanokura, M.' 4 'Takahashi, K.' 5 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Determination of the NMR structure of Gln25-ribonuclease T1.' 'Biol. Chem.' 384 1173 1183 2003 ? GE 1431-6730 ? ? 12974386 10.1515/BC.2003.130 1 ;Effects of replacement of Lys25 with Gln on the conformation of ribonuclease T1: sequence-specific 1H NMR resonance assignments of Gln25 ribonuclease T1 by two-dimensional NMR spectroscopy. ; 'J. Biochem.' 118 710 716 1995 ? JP 0021-924X ? ? 8576083 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hatano, K.' 1 ? primary 'Kojima, M.' 2 ? primary 'Suzuki, E.' 3 ? primary 'Tanokura, M.' 4 ? primary 'Takahashi, K.' 5 ? 1 'Kojima, M.' 6 ? 1 'Miyano, H.' 7 ? 1 'Suzuki, E.' 8 ? 1 'Tanokura, M.' 9 ? 1 'Takahashi, K.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'RIBONUCLEASE T1' _entity.formula_weight 11093.644 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.1.27.3 _entity.pdbx_mutation K25Q _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'GUANYLORIBONUCLEASE, RNASE T1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF NENNQLAGVITHTGASGNNFVECT ; _entity_poly.pdbx_seq_one_letter_code_can ;ACDYTCGSNCYSSSDVSTAQAAGYQLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF NENNQLAGVITHTGASGNNFVECT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 CYS n 1 3 ASP n 1 4 TYR n 1 5 THR n 1 6 CYS n 1 7 GLY n 1 8 SER n 1 9 ASN n 1 10 CYS n 1 11 TYR n 1 12 SER n 1 13 SER n 1 14 SER n 1 15 ASP n 1 16 VAL n 1 17 SER n 1 18 THR n 1 19 ALA n 1 20 GLN n 1 21 ALA n 1 22 ALA n 1 23 GLY n 1 24 TYR n 1 25 GLN n 1 26 LEU n 1 27 HIS n 1 28 GLU n 1 29 ASP n 1 30 GLY n 1 31 GLU n 1 32 THR n 1 33 VAL n 1 34 GLY n 1 35 SER n 1 36 ASN n 1 37 SER n 1 38 TYR n 1 39 PRO n 1 40 HIS n 1 41 LYS n 1 42 TYR n 1 43 ASN n 1 44 ASN n 1 45 TYR n 1 46 GLU n 1 47 GLY n 1 48 PHE n 1 49 ASP n 1 50 PHE n 1 51 SER n 1 52 VAL n 1 53 SER n 1 54 SER n 1 55 PRO n 1 56 TYR n 1 57 TYR n 1 58 GLU n 1 59 TRP n 1 60 PRO n 1 61 ILE n 1 62 LEU n 1 63 SER n 1 64 SER n 1 65 GLY n 1 66 ASP n 1 67 VAL n 1 68 TYR n 1 69 SER n 1 70 GLY n 1 71 GLY n 1 72 SER n 1 73 PRO n 1 74 GLY n 1 75 ALA n 1 76 ASP n 1 77 ARG n 1 78 VAL n 1 79 VAL n 1 80 PHE n 1 81 ASN n 1 82 GLU n 1 83 ASN n 1 84 ASN n 1 85 GLN n 1 86 LEU n 1 87 ALA n 1 88 GLY n 1 89 VAL n 1 90 ILE n 1 91 THR n 1 92 HIS n 1 93 THR n 1 94 GLY n 1 95 ALA n 1 96 SER n 1 97 GLY n 1 98 ASN n 1 99 ASN n 1 100 PHE n 1 101 VAL n 1 102 GLU n 1 103 CYS n 1 104 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name 'Yellow koji mold' _entity_src_gen.gene_src_genus Aspergillus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aspergillus oryzae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5062 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 THR 104 104 104 THR THR A . n # _exptl.entry_id 1IYY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1IYY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1IYY _struct.title 'NMR STRUCTURE OF Gln25-RIBONUCLEASE T1, 24 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1IYY _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'RIBONUCLEASE, ENDONUCLEASE, ENDORIBONUCLEASE, HYDROLASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A2NUJ9_ASPOZ _struct_ref.pdbx_db_accession A2NUJ9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF NENNQLAGVITHTGASGNNFVECT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1IYY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A2NUJ9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 104 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1IYY _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 25 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A2NUJ9 _struct_ref_seq_dif.db_mon_id LYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 25 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 25 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 5960 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? GLY A 30 ? SER A 12 GLY A 30 1 ? 19 HELX_P HELX_P2 2 ALA A 95 ? ASN A 99 ? ALA A 95 ASN A 99 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 10 SG ? ? A CYS 2 A CYS 10 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 6 A CYS 103 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 2 ? CYS A 10 ? CYS A 2 ? 1_555 CYS A 10 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 6 ? CYS A 103 ? CYS A 6 ? 1_555 CYS A 103 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 4 ? CYS A 6 ? TYR A 4 CYS A 6 A 2 ASN A 9 ? TYR A 11 ? ASN A 9 TYR A 11 B 1 TYR A 57 ? GLU A 58 ? TYR A 57 GLU A 58 B 2 ARG A 77 ? PHE A 80 ? ARG A 77 PHE A 80 B 3 GLY A 88 ? ILE A 90 ? GLY A 88 ILE A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 4 ? N TYR A 4 O TYR A 11 ? O TYR A 11 B 1 2 N TYR A 57 ? N TYR A 57 O PHE A 80 ? O PHE A 80 B 2 3 N VAL A 79 ? N VAL A 79 O GLY A 88 ? O GLY A 88 # _pdbx_entry_details.entry_id 1IYY _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 2 ? ? 38.93 94.20 2 1 TYR A 4 ? ? -115.07 65.73 3 1 SER A 8 ? ? 70.44 43.84 4 1 CYS A 10 ? ? -54.90 88.26 5 1 GLU A 31 ? ? -63.01 -154.81 6 1 SER A 35 ? ? 171.04 32.61 7 1 ASN A 36 ? ? -152.64 25.29 8 1 SER A 37 ? ? 47.95 92.75 9 1 ASN A 44 ? ? 77.20 135.59 10 1 TYR A 45 ? ? -159.50 -38.11 11 1 GLU A 46 ? ? -38.72 -73.02 12 1 ASP A 49 ? ? -145.05 26.59 13 1 PHE A 50 ? ? -45.60 173.08 14 1 SER A 51 ? ? -146.53 30.30 15 1 VAL A 52 ? ? -96.28 -92.13 16 1 SER A 64 ? ? -148.25 -54.20 17 1 ASP A 66 ? ? 175.49 -162.84 18 1 SER A 69 ? ? -177.19 74.14 19 1 SER A 72 ? ? -166.29 101.63 20 1 PRO A 73 ? ? -77.82 -81.71 21 1 ALA A 75 ? ? 56.47 -122.03 22 1 ARG A 77 ? ? -176.37 90.12 23 1 ASN A 81 ? ? -124.07 -81.15 24 1 GLU A 82 ? ? -158.74 21.55 25 1 ASN A 83 ? ? -140.39 23.89 26 1 ASN A 84 ? ? 52.83 19.92 27 1 GLN A 85 ? ? -60.62 -111.75 28 1 LEU A 86 ? ? 172.84 110.16 29 1 HIS A 92 ? ? -116.76 66.05 30 1 THR A 93 ? ? 178.42 -29.65 31 1 ASN A 98 ? ? 34.71 41.66 32 2 CYS A 2 ? ? 173.27 137.25 33 2 CYS A 6 ? ? -143.98 14.98 34 2 TYR A 24 ? ? -72.11 -70.65 35 2 VAL A 33 ? ? -100.30 -126.36 36 2 SER A 35 ? ? 163.99 -34.88 37 2 SER A 37 ? ? 69.29 121.78 38 2 ASN A 43 ? ? -74.77 21.66 39 2 ASN A 44 ? ? 60.42 148.63 40 2 TYR A 45 ? ? -174.39 -57.85 41 2 ASP A 49 ? ? -150.49 44.90 42 2 SER A 51 ? ? -153.22 56.68 43 2 SER A 53 ? ? 167.55 162.90 44 2 SER A 69 ? ? -155.91 20.36 45 2 ALA A 75 ? ? 51.01 -174.06 46 2 ASP A 76 ? ? -37.89 143.16 47 2 GLU A 82 ? ? 161.21 -21.54 48 2 GLN A 85 ? ? -60.66 -160.32 49 2 THR A 93 ? ? 177.36 -28.56 50 2 SER A 96 ? ? -40.95 157.02 51 2 ASN A 98 ? ? -127.28 -73.91 52 2 ASN A 99 ? ? 59.33 120.80 53 3 CYS A 2 ? ? 36.78 91.53 54 3 TYR A 4 ? ? -104.28 78.10 55 3 GLU A 31 ? ? -67.95 -144.55 56 3 VAL A 33 ? ? -105.03 -104.32 57 3 SER A 35 ? ? 162.83 -36.71 58 3 SER A 37 ? ? 63.09 126.37 59 3 ASN A 44 ? ? 60.26 92.17 60 3 GLU A 46 ? ? -101.42 -65.67 61 3 PHE A 48 ? ? -61.71 -171.07 62 3 SER A 51 ? ? 167.95 45.21 63 3 TYR A 57 ? ? -164.29 105.55 64 3 SER A 64 ? ? -99.45 -156.90 65 3 ASP A 66 ? ? -163.32 107.17 66 3 VAL A 67 ? ? -47.76 160.01 67 3 SER A 69 ? ? -168.08 39.41 68 3 PRO A 73 ? ? -79.85 -89.25 69 3 ALA A 75 ? ? 50.90 -87.23 70 3 ASN A 81 ? ? -124.35 -82.15 71 3 GLU A 82 ? ? -158.08 18.68 72 3 ASN A 83 ? ? -153.50 26.11 73 3 ASN A 84 ? ? 53.40 19.65 74 3 LEU A 86 ? ? 92.43 110.09 75 3 THR A 93 ? ? 171.76 148.38 76 3 ASN A 98 ? ? 32.90 52.40 77 4 CYS A 2 ? ? 165.30 126.86 78 4 GLU A 31 ? ? -97.56 -146.33 79 4 VAL A 33 ? ? -92.54 -100.53 80 4 SER A 37 ? ? 76.45 93.34 81 4 ASN A 43 ? ? -169.60 35.61 82 4 TYR A 45 ? ? -158.68 24.32 83 4 SER A 51 ? ? -144.39 34.76 84 4 SER A 53 ? ? 172.50 157.00 85 4 TYR A 57 ? ? -165.02 118.39 86 4 VAL A 67 ? ? 55.55 166.28 87 4 SER A 72 ? ? 64.42 74.19 88 4 ALA A 75 ? ? 67.39 -143.12 89 4 ASP A 76 ? ? 14.29 113.54 90 4 PHE A 80 ? ? 179.81 -169.15 91 4 GLU A 82 ? ? 159.51 -26.16 92 4 ASN A 84 ? ? 74.70 30.32 93 4 LEU A 86 ? ? 81.81 110.76 94 4 THR A 93 ? ? -179.66 -31.87 95 4 SER A 96 ? ? 47.69 -165.64 96 4 ASN A 98 ? ? -153.58 89.50 97 5 CYS A 2 ? ? 164.83 124.52 98 5 GLU A 31 ? ? -58.61 -166.94 99 5 THR A 32 ? ? -155.83 -93.61 100 5 SER A 35 ? ? -176.37 -51.07 101 5 ASN A 36 ? ? -51.39 -86.00 102 5 SER A 37 ? ? 160.33 -178.76 103 5 TYR A 38 ? ? 175.46 -49.38 104 5 ASN A 44 ? ? 62.92 127.30 105 5 TYR A 45 ? ? -161.68 -36.25 106 5 GLU A 46 ? ? -34.75 -72.83 107 5 SER A 51 ? ? -173.86 40.60 108 5 TYR A 56 ? ? -78.84 -169.15 109 5 TYR A 57 ? ? -162.72 106.73 110 5 SER A 69 ? ? -151.58 52.35 111 5 SER A 72 ? ? 53.77 87.40 112 5 ALA A 75 ? ? 69.38 -162.08 113 5 ASP A 76 ? ? -46.98 165.86 114 5 ARG A 77 ? ? -172.82 104.68 115 5 PHE A 80 ? ? -165.63 -169.49 116 5 GLU A 82 ? ? 163.31 -23.85 117 5 GLN A 85 ? ? -58.38 -162.34 118 5 HIS A 92 ? ? -119.66 53.88 119 5 THR A 93 ? ? -172.55 125.82 120 5 SER A 96 ? ? 42.11 74.13 121 5 ASN A 98 ? ? -150.17 -84.08 122 5 ASN A 99 ? ? 63.57 152.11 123 5 CYS A 103 ? ? -49.05 165.85 124 6 CYS A 2 ? ? -173.74 115.19 125 6 THR A 5 ? ? -108.56 67.64 126 6 SER A 8 ? ? -142.50 41.25 127 6 GLU A 31 ? ? -102.35 -166.99 128 6 VAL A 33 ? ? -89.02 -138.20 129 6 SER A 35 ? ? -161.43 -154.30 130 6 SER A 37 ? ? 168.76 108.34 131 6 ASN A 43 ? ? -145.33 18.41 132 6 ASN A 44 ? ? 62.03 108.46 133 6 PHE A 48 ? ? -61.66 -168.18 134 6 ASP A 49 ? ? -139.10 -44.15 135 6 PHE A 50 ? ? 64.17 177.58 136 6 SER A 53 ? ? -151.37 86.42 137 6 SER A 54 ? ? -172.58 -176.56 138 6 SER A 63 ? ? -118.57 54.80 139 6 SER A 64 ? ? -157.75 -43.80 140 6 VAL A 67 ? ? 62.30 167.37 141 6 PRO A 73 ? ? -77.72 -75.58 142 6 ALA A 75 ? ? 49.54 -167.18 143 6 ARG A 77 ? ? -164.82 70.84 144 6 PHE A 80 ? ? -172.04 -167.52 145 6 ASN A 81 ? ? -132.54 -78.47 146 6 GLU A 82 ? ? -160.76 24.58 147 6 ASN A 83 ? ? -146.03 17.55 148 6 ASN A 84 ? ? 47.45 25.68 149 6 LEU A 86 ? ? 85.87 115.87 150 6 THR A 93 ? ? 176.10 127.93 151 6 SER A 96 ? ? 43.95 78.95 152 6 ASN A 98 ? ? -125.56 -90.55 153 6 ASN A 99 ? ? 61.08 136.74 154 7 CYS A 2 ? ? 167.14 130.33 155 7 SER A 8 ? ? -162.62 49.07 156 7 GLU A 31 ? ? -103.91 -169.30 157 7 VAL A 33 ? ? -89.86 -98.13 158 7 SER A 35 ? ? 163.72 -46.92 159 7 SER A 37 ? ? 45.29 -162.15 160 7 TYR A 38 ? ? 167.01 -44.31 161 7 ASN A 44 ? ? 76.47 55.85 162 7 TYR A 45 ? ? -106.09 46.84 163 7 PHE A 48 ? ? -63.41 -169.15 164 7 ASP A 49 ? ? -154.43 36.54 165 7 PHE A 50 ? ? -62.16 -175.14 166 7 SER A 51 ? ? -144.72 35.38 167 7 VAL A 52 ? ? -92.90 -71.85 168 7 SER A 69 ? ? -174.82 54.90 169 7 ALA A 75 ? ? 64.04 -86.70 170 7 ASN A 81 ? ? -126.23 -83.47 171 7 GLU A 82 ? ? -151.43 8.59 172 7 LEU A 86 ? ? 85.81 109.00 173 7 THR A 93 ? ? 172.79 -28.61 174 7 ASN A 98 ? ? -165.56 38.24 175 7 ASN A 99 ? ? -50.72 179.57 176 7 GLU A 102 ? ? -39.42 138.67 177 8 CYS A 2 ? ? 178.20 133.02 178 8 ASN A 9 ? ? -123.80 -71.85 179 8 GLU A 31 ? ? -88.02 -144.66 180 8 VAL A 33 ? ? -102.17 -94.68 181 8 SER A 37 ? ? 68.28 105.15 182 8 ASN A 44 ? ? 40.24 -144.00 183 8 TYR A 45 ? ? 107.11 -20.76 184 8 ASP A 49 ? ? -143.88 -36.30 185 8 PHE A 50 ? ? 74.82 177.63 186 8 VAL A 52 ? ? -100.97 -72.19 187 8 SER A 64 ? ? 173.43 -31.57 188 8 ASP A 66 ? ? -170.05 -150.07 189 8 TYR A 68 ? ? -50.28 97.06 190 8 PRO A 73 ? ? -76.55 -159.07 191 8 ALA A 75 ? ? 48.11 -95.18 192 8 ASN A 81 ? ? -107.41 -80.05 193 8 GLU A 82 ? ? -167.85 23.62 194 8 ASN A 83 ? ? -149.49 21.72 195 8 ASN A 84 ? ? 80.72 8.11 196 8 GLN A 85 ? ? -56.91 -165.01 197 8 THR A 91 ? ? -135.81 -131.98 198 8 HIS A 92 ? ? 163.57 42.32 199 8 ALA A 95 ? ? 34.45 -154.97 200 8 ASN A 99 ? ? 37.21 -146.10 201 8 GLU A 102 ? ? -43.71 151.51 202 9 CYS A 2 ? ? 163.37 121.62 203 9 SER A 8 ? ? -174.46 30.01 204 9 GLU A 31 ? ? -71.43 -148.29 205 9 THR A 32 ? ? -170.61 -176.09 206 9 VAL A 33 ? ? -89.74 -126.89 207 9 SER A 35 ? ? -109.86 -93.09 208 9 SER A 37 ? ? 57.71 -158.75 209 9 TYR A 38 ? ? 166.84 -43.96 210 9 ASN A 43 ? ? -52.29 -88.52 211 9 ASN A 44 ? ? 161.97 135.07 212 9 PHE A 48 ? ? -63.85 87.16 213 9 PHE A 50 ? ? 44.93 -170.71 214 9 SER A 51 ? ? -151.55 32.28 215 9 VAL A 52 ? ? -113.48 -86.62 216 9 TYR A 56 ? ? -78.85 -164.63 217 9 SER A 64 ? ? -160.70 -55.74 218 9 ASP A 66 ? ? 60.51 -99.88 219 9 SER A 72 ? ? 51.73 93.03 220 9 PRO A 73 ? ? -78.57 -169.40 221 9 ALA A 75 ? ? 71.63 -162.21 222 9 ASP A 76 ? ? -36.51 154.31 223 9 ARG A 77 ? ? -177.92 70.40 224 9 ASN A 81 ? ? -129.40 -80.08 225 9 GLU A 82 ? ? -149.20 11.12 226 9 ASN A 83 ? ? -147.74 15.64 227 9 LEU A 86 ? ? 85.13 104.10 228 9 HIS A 92 ? ? -115.36 68.62 229 9 THR A 93 ? ? 172.50 158.93 230 9 ASN A 99 ? ? -45.58 170.95 231 10 CYS A 2 ? ? 174.00 124.56 232 10 GLU A 31 ? ? -125.67 -158.21 233 10 SER A 37 ? ? 176.04 -164.12 234 10 TYR A 38 ? ? 170.19 -45.12 235 10 ASN A 43 ? ? -165.59 95.48 236 10 ASN A 44 ? ? -135.71 -41.12 237 10 TYR A 45 ? ? 42.65 26.47 238 10 GLU A 46 ? ? -39.95 -27.63 239 10 PHE A 48 ? ? -92.46 49.94 240 10 ASP A 49 ? ? -48.53 103.14 241 10 SER A 69 ? ? -165.95 29.90 242 10 SER A 72 ? ? 51.11 92.62 243 10 PRO A 73 ? ? -79.11 -72.33 244 10 ALA A 75 ? ? 61.69 -149.88 245 10 ASP A 76 ? ? 28.29 108.62 246 10 GLU A 82 ? ? 162.44 -27.48 247 10 LEU A 86 ? ? 84.79 104.54 248 10 THR A 93 ? ? -176.32 -31.53 249 10 SER A 96 ? ? -39.86 128.18 250 10 ASN A 98 ? ? -139.44 -64.24 251 10 ASN A 99 ? ? 47.35 -172.60 252 11 CYS A 2 ? ? 163.52 142.46 253 11 SER A 35 ? ? -73.92 -144.36 254 11 ASN A 36 ? ? -102.11 60.49 255 11 SER A 37 ? ? 70.97 -168.97 256 11 TYR A 38 ? ? 165.07 -41.96 257 11 ASN A 44 ? ? -89.74 -78.26 258 11 GLU A 46 ? ? -36.24 -71.21 259 11 PHE A 50 ? ? 55.41 178.13 260 11 SER A 51 ? ? -146.48 37.57 261 11 VAL A 52 ? ? -110.12 -82.61 262 11 SER A 63 ? ? -146.72 55.10 263 11 SER A 64 ? ? -166.31 30.94 264 11 ASP A 66 ? ? -161.16 -36.33 265 11 VAL A 67 ? ? 71.81 140.49 266 11 ALA A 75 ? ? 65.03 -84.98 267 11 ASN A 81 ? ? -118.68 -80.16 268 11 GLU A 82 ? ? -158.55 20.59 269 11 ASN A 83 ? ? -150.84 18.37 270 11 LEU A 86 ? ? 66.49 116.31 271 11 THR A 93 ? ? 173.44 -28.58 272 11 ASN A 98 ? ? -136.22 -79.70 273 11 ASN A 99 ? ? 58.51 152.20 274 12 CYS A 2 ? ? 173.54 126.85 275 12 CYS A 10 ? ? 40.03 79.09 276 12 GLU A 31 ? ? -106.06 -164.11 277 12 VAL A 33 ? ? -87.99 -156.69 278 12 SER A 35 ? ? 167.15 -27.21 279 12 SER A 37 ? ? 46.20 -169.23 280 12 TYR A 38 ? ? 169.42 -47.18 281 12 ASN A 44 ? ? 45.28 -160.23 282 12 TYR A 45 ? ? 171.43 -26.40 283 12 ASP A 49 ? ? -108.89 76.31 284 12 PHE A 50 ? ? -66.63 -178.53 285 12 SER A 51 ? ? -140.41 17.38 286 12 VAL A 52 ? ? -88.10 -82.67 287 12 TYR A 57 ? ? -160.88 114.91 288 12 SER A 64 ? ? -133.22 -62.72 289 12 ASP A 66 ? ? -179.45 134.12 290 12 VAL A 67 ? ? 62.79 133.96 291 12 PRO A 73 ? ? -76.65 -161.81 292 12 ALA A 75 ? ? 61.85 -150.05 293 12 ASP A 76 ? ? -32.27 148.73 294 12 ARG A 77 ? ? -176.38 86.35 295 12 PHE A 80 ? ? -174.76 -169.19 296 12 ASN A 81 ? ? -128.88 -80.99 297 12 GLU A 82 ? ? -158.60 19.69 298 12 ASN A 83 ? ? -150.34 28.85 299 12 LEU A 86 ? ? 82.19 104.16 300 12 THR A 93 ? ? 176.17 123.74 301 12 SER A 96 ? ? 41.65 85.55 302 12 ASN A 98 ? ? -144.54 -77.02 303 12 ASN A 99 ? ? 59.43 155.59 304 13 CYS A 2 ? ? 169.72 115.50 305 13 SER A 8 ? ? -161.08 55.36 306 13 ASN A 9 ? ? -117.28 -144.65 307 13 CYS A 10 ? ? -162.44 60.46 308 13 GLU A 31 ? ? -83.43 -149.00 309 13 VAL A 33 ? ? -82.94 -95.09 310 13 SER A 35 ? ? 167.21 -42.33 311 13 SER A 37 ? ? 62.08 135.59 312 13 ASN A 43 ? ? -85.87 -90.63 313 13 ASN A 44 ? ? 174.49 148.05 314 13 TYR A 45 ? ? -139.69 -72.61 315 13 PHE A 50 ? ? 47.26 -168.55 316 13 SER A 51 ? ? -168.83 31.76 317 13 VAL A 52 ? ? -108.52 -66.61 318 13 SER A 64 ? ? -150.69 -46.62 319 13 ASP A 66 ? ? 175.61 -62.58 320 13 SER A 69 ? ? -161.44 53.31 321 13 ALA A 75 ? ? 55.88 -153.18 322 13 ASP A 76 ? ? 20.75 106.74 323 13 ASN A 81 ? ? -112.48 -81.75 324 13 GLU A 82 ? ? -162.64 21.78 325 13 ASN A 83 ? ? -140.61 29.50 326 13 ASN A 84 ? ? 46.95 24.50 327 13 GLN A 85 ? ? -63.61 -106.73 328 13 LEU A 86 ? ? 174.42 114.55 329 13 THR A 93 ? ? 177.54 164.02 330 13 ALA A 95 ? ? -155.81 51.84 331 13 SER A 96 ? ? 68.07 93.66 332 13 ASN A 98 ? ? -139.07 -83.18 333 13 ASN A 99 ? ? 61.23 137.88 334 14 CYS A 2 ? ? 62.38 91.93 335 14 CYS A 10 ? ? 41.33 80.40 336 14 GLU A 31 ? ? -94.43 -145.27 337 14 VAL A 33 ? ? -89.41 -120.76 338 14 SER A 35 ? ? 169.72 -38.66 339 14 SER A 37 ? ? 59.66 114.16 340 14 ASN A 44 ? ? 62.16 175.00 341 14 TYR A 45 ? ? -179.15 -45.25 342 14 PHE A 50 ? ? 50.93 -170.52 343 14 SER A 51 ? ? -155.21 44.42 344 14 SER A 53 ? ? 167.72 -176.65 345 14 ASP A 66 ? ? -175.58 139.29 346 14 SER A 69 ? ? -169.20 49.87 347 14 SER A 72 ? ? 75.14 109.70 348 14 ALA A 75 ? ? 47.74 -154.77 349 14 ASP A 76 ? ? -39.53 129.26 350 14 PHE A 80 ? ? -173.92 -167.87 351 14 ASN A 81 ? ? -120.49 -80.57 352 14 GLU A 82 ? ? -163.43 23.98 353 14 ASN A 83 ? ? -148.91 16.28 354 14 LEU A 86 ? ? 84.95 110.58 355 14 SER A 96 ? ? 43.78 79.35 356 14 ASN A 98 ? ? -148.76 -82.15 357 14 ASN A 99 ? ? 60.73 138.75 358 15 CYS A 2 ? ? 176.45 98.12 359 15 THR A 5 ? ? -101.10 69.44 360 15 SER A 8 ? ? -159.28 40.85 361 15 VAL A 33 ? ? -102.56 -79.06 362 15 SER A 35 ? ? 163.32 -33.38 363 15 ASN A 36 ? ? -76.77 -77.20 364 15 SER A 37 ? ? 158.10 128.60 365 15 ASN A 43 ? ? -110.24 -75.22 366 15 ASN A 44 ? ? 77.15 -76.03 367 15 PHE A 50 ? ? 80.54 173.82 368 15 VAL A 52 ? ? -98.58 -67.14 369 15 SER A 63 ? ? -172.48 56.32 370 15 SER A 64 ? ? 177.14 36.37 371 15 SER A 69 ? ? -159.90 21.90 372 15 ALA A 75 ? ? 77.60 -152.02 373 15 ARG A 77 ? ? 175.10 96.59 374 15 ASN A 81 ? ? -124.00 -81.77 375 15 GLU A 82 ? ? -156.40 12.82 376 15 LEU A 86 ? ? 89.21 103.28 377 15 ASN A 98 ? ? -144.38 -81.96 378 15 ASN A 99 ? ? 57.06 159.29 379 15 GLU A 102 ? ? -39.98 136.83 380 16 CYS A 2 ? ? 173.94 106.91 381 16 ASN A 9 ? ? -79.67 -168.18 382 16 GLU A 31 ? ? -81.27 -157.17 383 16 VAL A 33 ? ? -110.33 -70.44 384 16 SER A 37 ? ? 68.30 73.51 385 16 ASN A 44 ? ? 62.10 130.20 386 16 TYR A 45 ? ? -161.44 -38.54 387 16 SER A 51 ? ? -177.40 57.08 388 16 TYR A 68 ? ? 39.17 -162.69 389 16 SER A 69 ? ? 53.11 173.22 390 16 SER A 72 ? ? -161.26 85.95 391 16 PRO A 73 ? ? -79.95 44.05 392 16 ALA A 75 ? ? 72.28 -141.89 393 16 ASP A 76 ? ? -34.20 131.14 394 16 ARG A 77 ? ? -167.24 110.11 395 16 PHE A 80 ? ? -174.02 -172.46 396 16 ASN A 81 ? ? -125.33 -84.90 397 16 ASN A 84 ? ? 75.10 32.43 398 16 LEU A 86 ? ? 84.99 103.95 399 16 THR A 93 ? ? 178.96 -30.20 400 16 ASN A 98 ? ? -151.90 -86.81 401 16 ASN A 99 ? ? 61.04 129.97 402 17 CYS A 2 ? ? -178.77 88.17 403 17 CYS A 10 ? ? -49.74 89.29 404 17 GLU A 31 ? ? -102.17 -147.72 405 17 VAL A 33 ? ? -98.81 -139.50 406 17 SER A 35 ? ? 173.62 -31.70 407 17 SER A 37 ? ? 71.84 -165.33 408 17 TYR A 38 ? ? 167.64 -45.03 409 17 ASN A 43 ? ? -137.82 -71.99 410 17 ASN A 44 ? ? 80.18 -69.66 411 17 PHE A 50 ? ? 55.21 179.12 412 17 VAL A 52 ? ? -95.42 -92.60 413 17 SER A 53 ? ? -166.27 -168.84 414 17 TYR A 57 ? ? -161.66 106.94 415 17 SER A 64 ? ? -103.37 -71.48 416 17 ASP A 66 ? ? 179.87 -36.03 417 17 SER A 69 ? ? -152.74 -43.43 418 17 PRO A 73 ? ? -79.59 -159.05 419 17 ALA A 75 ? ? 70.86 -80.85 420 17 ARG A 77 ? ? -155.99 84.82 421 17 ASN A 81 ? ? -121.08 -83.08 422 17 GLU A 82 ? ? -141.91 -9.44 423 17 LEU A 86 ? ? 85.18 103.62 424 17 THR A 93 ? ? -176.20 25.21 425 17 ASN A 98 ? ? -138.36 -76.32 426 17 ASN A 99 ? ? 59.94 154.56 427 17 CYS A 103 ? ? -56.36 109.03 428 18 CYS A 2 ? ? 173.96 99.36 429 18 GLU A 31 ? ? -105.49 -158.78 430 18 SER A 35 ? ? -175.09 28.09 431 18 SER A 37 ? ? 48.98 -165.98 432 18 TYR A 38 ? ? 168.70 -44.88 433 18 ASN A 43 ? ? -81.79 37.91 434 18 ASN A 44 ? ? 39.92 -160.99 435 18 TYR A 45 ? ? 167.25 -67.31 436 18 SER A 51 ? ? -153.48 42.25 437 18 SER A 53 ? ? 176.70 -174.47 438 18 VAL A 67 ? ? 60.80 143.96 439 18 TYR A 68 ? ? -55.53 108.79 440 18 SER A 69 ? ? -173.68 48.03 441 18 SER A 72 ? ? 60.68 68.05 442 18 ALA A 75 ? ? 80.17 -77.95 443 18 ASN A 81 ? ? -123.95 -81.41 444 18 GLU A 82 ? ? -159.24 18.08 445 18 ASN A 84 ? ? 48.02 23.32 446 18 GLN A 85 ? ? -67.68 -90.08 447 18 LEU A 86 ? ? 165.39 106.80 448 18 THR A 93 ? ? -168.40 23.09 449 18 ALA A 95 ? ? -177.89 117.93 450 18 SER A 96 ? ? 46.06 -159.13 451 18 ASN A 98 ? ? -152.12 -76.02 452 18 ASN A 99 ? ? 60.91 146.05 453 18 CYS A 103 ? ? -54.13 98.36 454 19 CYS A 2 ? ? 174.29 156.64 455 19 GLU A 31 ? ? -79.34 -169.29 456 19 VAL A 33 ? ? -82.31 -98.35 457 19 SER A 35 ? ? 78.96 -10.63 458 19 SER A 37 ? ? 58.13 -175.06 459 19 TYR A 38 ? ? 168.27 -44.94 460 19 ASN A 43 ? ? -117.49 66.02 461 19 ASN A 44 ? ? -40.00 147.72 462 19 PHE A 50 ? ? -78.33 -169.22 463 19 SER A 64 ? ? -128.96 -148.99 464 19 ALA A 75 ? ? 66.33 -83.94 465 19 ARG A 77 ? ? -170.35 114.75 466 19 PHE A 80 ? ? -163.16 -168.46 467 19 GLU A 82 ? ? 163.10 -25.89 468 19 LEU A 86 ? ? 88.06 114.18 469 19 THR A 93 ? ? -175.07 118.23 470 19 ASN A 98 ? ? 36.02 44.18 471 20 CYS A 2 ? ? 168.75 145.48 472 20 CYS A 10 ? ? -97.83 58.89 473 20 SER A 35 ? ? 179.73 30.27 474 20 SER A 37 ? ? 47.39 -173.64 475 20 TYR A 38 ? ? 164.45 -44.15 476 20 PHE A 50 ? ? -52.52 -171.32 477 20 SER A 51 ? ? -158.12 37.29 478 20 VAL A 52 ? ? -108.97 -73.79 479 20 TYR A 57 ? ? -160.65 118.58 480 20 VAL A 67 ? ? 61.77 131.27 481 20 TYR A 68 ? ? -46.81 107.32 482 20 ALA A 75 ? ? 79.84 -70.54 483 20 ARG A 77 ? ? -163.47 105.68 484 20 GLU A 82 ? ? 167.15 -25.07 485 20 GLN A 85 ? ? -57.13 -82.07 486 20 LEU A 86 ? ? 165.28 108.87 487 20 THR A 93 ? ? 176.52 -27.25 488 20 ASN A 98 ? ? -160.52 -68.07 489 20 ASN A 99 ? ? 57.05 -173.36 490 21 CYS A 2 ? ? 167.17 115.83 491 21 TYR A 4 ? ? -104.99 71.35 492 21 SER A 8 ? ? -166.98 36.03 493 21 CYS A 10 ? ? 40.40 76.44 494 21 GLU A 31 ? ? -97.70 -152.19 495 21 THR A 32 ? ? -177.27 -93.05 496 21 SER A 37 ? ? 45.27 76.82 497 21 ASN A 44 ? ? 42.22 104.79 498 21 TYR A 45 ? ? -131.88 -33.23 499 21 PHE A 50 ? ? -50.36 -178.49 500 21 VAL A 52 ? ? -85.74 -82.00 501 21 ALA A 75 ? ? 60.23 -85.83 502 21 ASN A 81 ? ? -109.11 -80.13 503 21 GLU A 82 ? ? -161.90 23.36 504 21 ASN A 83 ? ? -151.70 51.38 505 21 ASN A 84 ? ? 44.86 26.95 506 21 GLN A 85 ? ? -64.40 -163.18 507 21 HIS A 92 ? ? -115.50 71.90 508 21 THR A 93 ? ? -176.61 133.13 509 21 ASN A 98 ? ? 32.92 40.75 510 22 CYS A 2 ? ? 166.49 138.06 511 22 SER A 8 ? ? 55.15 19.06 512 22 ASN A 9 ? ? -75.07 -156.88 513 22 CYS A 10 ? ? -155.49 58.14 514 22 GLU A 31 ? ? -87.10 -137.59 515 22 VAL A 33 ? ? -83.26 -138.72 516 22 SER A 35 ? ? 177.75 -32.78 517 22 SER A 37 ? ? 67.66 -172.69 518 22 TYR A 38 ? ? 167.53 -45.05 519 22 ASN A 43 ? ? -78.47 -106.61 520 22 ASN A 44 ? ? 154.42 95.56 521 22 PHE A 50 ? ? -61.37 -167.06 522 22 SER A 51 ? ? -149.07 27.75 523 22 VAL A 52 ? ? -101.05 -80.08 524 22 SER A 64 ? ? -162.23 25.34 525 22 VAL A 67 ? ? 62.37 174.79 526 22 SER A 69 ? ? -151.89 21.27 527 22 ALA A 75 ? ? 70.41 -150.57 528 22 ASP A 76 ? ? -7.08 126.46 529 22 ARG A 77 ? ? -161.89 80.71 530 22 ASN A 81 ? ? -116.22 -82.07 531 22 GLU A 82 ? ? -153.08 10.64 532 22 GLN A 85 ? ? -49.38 -92.02 533 22 LEU A 86 ? ? 170.72 106.75 534 22 SER A 96 ? ? 46.09 -160.50 535 22 ASN A 98 ? ? -155.68 -74.89 536 22 ASN A 99 ? ? 62.34 132.43 537 23 CYS A 2 ? ? 178.18 105.87 538 23 SER A 8 ? ? 70.07 54.01 539 23 ASN A 9 ? ? -155.69 89.42 540 23 GLU A 31 ? ? -128.67 -152.46 541 23 SER A 35 ? ? -177.29 25.73 542 23 ASN A 36 ? ? -147.84 13.16 543 23 SER A 37 ? ? 64.40 -170.25 544 23 TYR A 38 ? ? 170.33 -44.99 545 23 ASN A 44 ? ? 40.06 93.80 546 23 PHE A 50 ? ? 47.33 -170.92 547 23 SER A 51 ? ? -146.55 20.22 548 23 VAL A 52 ? ? -92.91 -83.29 549 23 SER A 69 ? ? -158.68 -53.20 550 23 ALA A 75 ? ? 64.76 -83.78 551 23 GLU A 82 ? ? 166.85 -27.30 552 23 ASN A 84 ? ? 46.24 27.52 553 23 LEU A 86 ? ? 85.94 105.25 554 23 THR A 93 ? ? 178.92 24.63 555 23 SER A 96 ? ? 36.33 54.32 556 23 ASN A 98 ? ? -138.16 -69.52 557 23 ASN A 99 ? ? 44.82 -167.65 558 23 GLU A 102 ? ? -42.98 105.66 559 24 CYS A 2 ? ? 164.96 99.62 560 24 CYS A 10 ? ? -104.28 75.95 561 24 GLU A 31 ? ? -65.64 -173.90 562 24 THR A 32 ? ? -161.53 -94.75 563 24 VAL A 33 ? ? -135.62 -114.23 564 24 SER A 37 ? ? 45.32 88.16 565 24 ASN A 43 ? ? -109.95 -84.98 566 24 ASN A 44 ? ? 155.99 135.07 567 24 TYR A 45 ? ? -152.41 -64.88 568 24 PHE A 48 ? ? 66.91 157.09 569 24 SER A 51 ? ? -170.08 54.81 570 24 SER A 64 ? ? -153.87 -39.08 571 24 ASP A 66 ? ? 48.09 96.88 572 24 VAL A 67 ? ? 75.62 135.69 573 24 SER A 69 ? ? -165.47 -42.30 574 24 ALA A 75 ? ? 71.52 -144.91 575 24 ASP A 76 ? ? -44.11 151.54 576 24 ARG A 77 ? ? -164.95 111.84 577 24 GLU A 82 ? ? 166.26 -27.31 578 24 ASN A 84 ? ? 48.70 25.27 579 24 LEU A 86 ? ? 83.59 104.11 580 24 THR A 93 ? ? -175.75 -30.37 581 24 SER A 96 ? ? 39.28 -156.38 582 24 ASN A 98 ? ? -167.43 32.65 583 24 ASN A 99 ? ? -48.14 173.95 584 24 GLU A 102 ? ? -49.87 96.08 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 77 ? ? 0.303 'SIDE CHAIN' 2 2 ARG A 77 ? ? 0.309 'SIDE CHAIN' 3 4 ARG A 77 ? ? 0.277 'SIDE CHAIN' 4 5 ARG A 77 ? ? 0.107 'SIDE CHAIN' 5 6 ARG A 77 ? ? 0.270 'SIDE CHAIN' 6 7 ARG A 77 ? ? 0.097 'SIDE CHAIN' 7 9 ARG A 77 ? ? 0.122 'SIDE CHAIN' 8 10 ARG A 77 ? ? 0.248 'SIDE CHAIN' 9 11 ARG A 77 ? ? 0.305 'SIDE CHAIN' 10 12 ARG A 77 ? ? 0.114 'SIDE CHAIN' 11 13 ARG A 77 ? ? 0.302 'SIDE CHAIN' 12 14 ARG A 77 ? ? 0.148 'SIDE CHAIN' 13 15 ARG A 77 ? ? 0.289 'SIDE CHAIN' 14 16 ARG A 77 ? ? 0.316 'SIDE CHAIN' 15 17 ARG A 77 ? ? 0.193 'SIDE CHAIN' 16 18 ARG A 77 ? ? 0.317 'SIDE CHAIN' 17 19 ARG A 77 ? ? 0.312 'SIDE CHAIN' 18 20 ARG A 77 ? ? 0.299 'SIDE CHAIN' 19 21 ARG A 77 ? ? 0.294 'SIDE CHAIN' 20 22 ARG A 77 ? ? 0.136 'SIDE CHAIN' 21 23 ARG A 77 ? ? 0.285 'SIDE CHAIN' 22 24 ARG A 77 ? ? 0.314 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 1IYY _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 24 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM Ribonuclease T1' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_details.entry_id 1IYY _pdbx_nmr_details.text ;Structures were refined by 1340 NOES (392 INTRARESIDUE, 384 SEQUENTIAL AND 564 LONG-RANGE NOES) using A DG/SA protocol. 37 assignments for 14 CHI-1 ANGLE, 21 PHI ANGLE AND 2 OMEGA ANGLE constraints were included during the course of the refinement. ; # _pdbx_nmr_refine.entry_id 1IYY _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.1 refinement ? 1 X-PLOR 3.1 'structure solution' ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 TRP N N N N 298 TRP CA C N S 299 TRP C C N N 300 TRP O O N N 301 TRP CB C N N 302 TRP CG C Y N 303 TRP CD1 C Y N 304 TRP CD2 C Y N 305 TRP NE1 N Y N 306 TRP CE2 C Y N 307 TRP CE3 C Y N 308 TRP CZ2 C Y N 309 TRP CZ3 C Y N 310 TRP CH2 C Y N 311 TRP OXT O N N 312 TRP H H N N 313 TRP H2 H N N 314 TRP HA H N N 315 TRP HB2 H N N 316 TRP HB3 H N N 317 TRP HD1 H N N 318 TRP HE1 H N N 319 TRP HE3 H N N 320 TRP HZ2 H N N 321 TRP HZ3 H N N 322 TRP HH2 H N N 323 TRP HXT H N N 324 TYR N N N N 325 TYR CA C N S 326 TYR C C N N 327 TYR O O N N 328 TYR CB C N N 329 TYR CG C Y N 330 TYR CD1 C Y N 331 TYR CD2 C Y N 332 TYR CE1 C Y N 333 TYR CE2 C Y N 334 TYR CZ C Y N 335 TYR OH O N N 336 TYR OXT O N N 337 TYR H H N N 338 TYR H2 H N N 339 TYR HA H N N 340 TYR HB2 H N N 341 TYR HB3 H N N 342 TYR HD1 H N N 343 TYR HD2 H N N 344 TYR HE1 H N N 345 TYR HE2 H N N 346 TYR HH H N N 347 TYR HXT H N N 348 VAL N N N N 349 VAL CA C N S 350 VAL C C N N 351 VAL O O N N 352 VAL CB C N N 353 VAL CG1 C N N 354 VAL CG2 C N N 355 VAL OXT O N N 356 VAL H H N N 357 VAL H2 H N N 358 VAL HA H N N 359 VAL HB H N N 360 VAL HG11 H N N 361 VAL HG12 H N N 362 VAL HG13 H N N 363 VAL HG21 H N N 364 VAL HG22 H N N 365 VAL HG23 H N N 366 VAL HXT H N N 367 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TRP N CA sing N N 285 TRP N H sing N N 286 TRP N H2 sing N N 287 TRP CA C sing N N 288 TRP CA CB sing N N 289 TRP CA HA sing N N 290 TRP C O doub N N 291 TRP C OXT sing N N 292 TRP CB CG sing N N 293 TRP CB HB2 sing N N 294 TRP CB HB3 sing N N 295 TRP CG CD1 doub Y N 296 TRP CG CD2 sing Y N 297 TRP CD1 NE1 sing Y N 298 TRP CD1 HD1 sing N N 299 TRP CD2 CE2 doub Y N 300 TRP CD2 CE3 sing Y N 301 TRP NE1 CE2 sing Y N 302 TRP NE1 HE1 sing N N 303 TRP CE2 CZ2 sing Y N 304 TRP CE3 CZ3 doub Y N 305 TRP CE3 HE3 sing N N 306 TRP CZ2 CH2 doub Y N 307 TRP CZ2 HZ2 sing N N 308 TRP CZ3 CH2 sing Y N 309 TRP CZ3 HZ3 sing N N 310 TRP CH2 HH2 sing N N 311 TRP OXT HXT sing N N 312 TYR N CA sing N N 313 TYR N H sing N N 314 TYR N H2 sing N N 315 TYR CA C sing N N 316 TYR CA CB sing N N 317 TYR CA HA sing N N 318 TYR C O doub N N 319 TYR C OXT sing N N 320 TYR CB CG sing N N 321 TYR CB HB2 sing N N 322 TYR CB HB3 sing N N 323 TYR CG CD1 doub Y N 324 TYR CG CD2 sing Y N 325 TYR CD1 CE1 sing Y N 326 TYR CD1 HD1 sing N N 327 TYR CD2 CE2 doub Y N 328 TYR CD2 HD2 sing N N 329 TYR CE1 CZ doub Y N 330 TYR CE1 HE1 sing N N 331 TYR CE2 CZ sing Y N 332 TYR CE2 HE2 sing N N 333 TYR CZ OH sing N N 334 TYR OH HH sing N N 335 TYR OXT HXT sing N N 336 VAL N CA sing N N 337 VAL N H sing N N 338 VAL N H2 sing N N 339 VAL CA C sing N N 340 VAL CA CB sing N N 341 VAL CA HA sing N N 342 VAL C O doub N N 343 VAL C OXT sing N N 344 VAL CB CG1 sing N N 345 VAL CB CG2 sing N N 346 VAL CB HB sing N N 347 VAL CG1 HG11 sing N N 348 VAL CG1 HG12 sing N N 349 VAL CG1 HG13 sing N N 350 VAL CG2 HG21 sing N N 351 VAL CG2 HG22 sing N N 352 VAL CG2 HG23 sing N N 353 VAL OXT HXT sing N N 354 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AMX _pdbx_nmr_spectrometer.field_strength 600 # _atom_sites.entry_id 1IYY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_