data_1J8C # _entry.id 1J8C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1J8C pdb_00001j8c 10.2210/pdb1j8c/pdb RCSB RCSB013486 ? ? WWPDB D_1000013486 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-03-20 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1J8C _pdbx_database_status.recvd_initial_deposition_date 2001-05-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Walters, K.J.' 1 'Kleijnen, M.F.' 2 'Goh, A.M.' 3 'Wagner, G.' 4 'Howley, P.M.' 5 # _citation.id primary _citation.title 'Structural studies of the interaction between ubiquitin family proteins and proteasome subunit S5a.' _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 1767 _citation.page_last 1777 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11827521 _citation.pdbx_database_id_DOI 10.1021/bi011892y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Walters, K.J.' 1 ? primary 'Kleijnen, M.F.' 2 ? primary 'Goh, A.M.' 3 ? primary 'Wagner, G.' 4 ? primary 'Howley, P.M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ubiquitin-like protein hPLIC-2' _entity.formula_weight 13637.364 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain (residues 1-103)' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKI LKDQDTLIQHGIHDGLTVHLVIKRDPNSSSVDKYAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKI LKDQDTLIQHGIHDGLTVHLVIKRDPNSSSVDKYAAALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ASN n 1 5 GLY n 1 6 GLU n 1 7 SER n 1 8 SER n 1 9 GLY n 1 10 PRO n 1 11 PRO n 1 12 ARG n 1 13 PRO n 1 14 SER n 1 15 ARG n 1 16 GLY n 1 17 PRO n 1 18 ALA n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 GLY n 1 23 SER n 1 24 ALA n 1 25 ALA n 1 26 ALA n 1 27 PRO n 1 28 ALA n 1 29 GLU n 1 30 PRO n 1 31 LYS n 1 32 ILE n 1 33 ILE n 1 34 LYS n 1 35 VAL n 1 36 THR n 1 37 VAL n 1 38 LYS n 1 39 THR n 1 40 PRO n 1 41 LYS n 1 42 GLU n 1 43 LYS n 1 44 GLU n 1 45 GLU n 1 46 PHE n 1 47 ALA n 1 48 VAL n 1 49 PRO n 1 50 GLU n 1 51 ASN n 1 52 SER n 1 53 SER n 1 54 VAL n 1 55 GLN n 1 56 GLN n 1 57 PHE n 1 58 LYS n 1 59 GLU n 1 60 ALA n 1 61 ILE n 1 62 SER n 1 63 LYS n 1 64 ARG n 1 65 PHE n 1 66 LYS n 1 67 SER n 1 68 GLN n 1 69 THR n 1 70 ASP n 1 71 GLN n 1 72 LEU n 1 73 VAL n 1 74 LEU n 1 75 ILE n 1 76 PHE n 1 77 ALA n 1 78 GLY n 1 79 LYS n 1 80 ILE n 1 81 LEU n 1 82 LYS n 1 83 ASP n 1 84 GLN n 1 85 ASP n 1 86 THR n 1 87 LEU n 1 88 ILE n 1 89 GLN n 1 90 HIS n 1 91 GLY n 1 92 ILE n 1 93 HIS n 1 94 ASP n 1 95 GLY n 1 96 LEU n 1 97 THR n 1 98 VAL n 1 99 HIS n 1 100 LEU n 1 101 VAL n 1 102 ILE n 1 103 LYS n 1 104 ARG n 1 105 ASP n 1 106 PRO n 1 107 ASN n 1 108 SER n 1 109 SER n 1 110 SER n 1 111 VAL n 1 112 ASP n 1 113 LYS n 1 114 TYR n 1 115 ALA n 1 116 ALA n 1 117 ALA n 1 118 LEU n 1 119 GLU n 1 120 HIS n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ARG 104 104 ? ? ? A . n A 1 105 ASP 105 105 ? ? ? A . n A 1 106 PRO 106 106 ? ? ? A . n A 1 107 ASN 107 107 ? ? ? A . n A 1 108 SER 108 108 ? ? ? A . n A 1 109 SER 109 109 ? ? ? A . n A 1 110 SER 110 110 ? ? ? A . n A 1 111 VAL 111 111 ? ? ? A . n A 1 112 ASP 112 112 ? ? ? A . n A 1 113 LYS 113 113 ? ? ? A . n A 1 114 TYR 114 114 ? ? ? A . n A 1 115 ALA 115 115 ? ? ? A . n A 1 116 ALA 116 116 ? ? ? A . n A 1 117 ALA 117 117 ? ? ? A . n A 1 118 LEU 118 118 ? ? ? A . n A 1 119 GLU 119 119 ? ? ? A . n A 1 120 HIS 120 120 ? ? ? A . n A 1 121 HIS 121 121 ? ? ? A . n A 1 122 HIS 122 122 ? ? ? A . n A 1 123 HIS 123 123 ? ? ? A . n A 1 124 HIS 124 124 ? ? ? A . n A 1 125 HIS 125 125 ? ? ? A . n # _exptl.entry_id 1J8C _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1J8C _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1J8C _struct.title 'Solution Structure of the Ubiquitin-like Domain of hPLIC-2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1J8C _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS' _struct_keywords.text 'ubiquitin-like domain, STRUCTURAL GENOMICS' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBQL2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKI LKDQDTLIQHGIHDGLTVHLVIKRDPNSSSVDKYAAALEHHHHHH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9UHD9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1J8C _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UHD9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1J8C ARG A 104 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 104 1 1 1J8C ASP A 105 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 105 2 1 1J8C PRO A 106 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 106 3 1 1J8C ASN A 107 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 107 4 1 1J8C SER A 108 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 108 5 1 1J8C SER A 109 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 109 6 1 1J8C SER A 110 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 110 7 1 1J8C VAL A 111 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 111 8 1 1J8C ASP A 112 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 112 9 1 1J8C LYS A 113 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 113 10 1 1J8C TYR A 114 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 114 11 1 1J8C ALA A 115 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 115 12 1 1J8C ALA A 116 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 116 13 1 1J8C ALA A 117 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 117 14 1 1J8C LEU A 118 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 118 15 1 1J8C GLU A 119 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 119 16 1 1J8C HIS A 120 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 120 17 1 1J8C HIS A 121 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 121 18 1 1J8C HIS A 122 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 122 19 1 1J8C HIS A 123 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 123 20 1 1J8C HIS A 124 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 124 21 1 1J8C HIS A 125 ? UNP Q9UHD9 ? ? 'SEE REMARK 999' 125 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 53 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 66 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 53 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 66 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 43 ? VAL A 48 ? LYS A 43 VAL A 48 A 2 ILE A 33 ? LYS A 38 ? ILE A 33 LYS A 38 A 3 LEU A 96 ? ILE A 102 ? LEU A 96 ILE A 102 A 4 LEU A 72 ? PHE A 76 ? LEU A 72 PHE A 76 A 5 LYS A 79 ? LEU A 81 ? LYS A 79 LEU A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O PHE A 46 ? O PHE A 46 N VAL A 35 ? N VAL A 35 A 2 3 N THR A 36 ? N THR A 36 O LEU A 96 ? O LEU A 96 A 3 4 O HIS A 99 ? O HIS A 99 N ILE A 75 ? N ILE A 75 A 4 5 N LEU A 74 ? N LEU A 74 O LEU A 81 ? O LEU A 81 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A VAL 54 ? ? H A LYS 58 ? ? 1.59 2 3 O A PRO 30 ? ? H A ILE 32 ? ? 1.59 3 6 HG1 A THR 39 ? ? O A GLU 42 ? ? 1.59 4 13 O A GLU 59 ? ? HG A SER 62 ? ? 1.53 5 15 O A GLU 59 ? ? HG A SER 62 ? ? 1.51 6 16 O A LEU 87 ? ? H A ILE 92 ? ? 1.53 7 17 O A VAL 54 ? ? H A LYS 58 ? ? 1.60 8 19 O A ILE 92 ? ? HD1 A HIS 93 ? ? 1.56 9 20 O A LEU 87 ? ? H A ILE 92 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -147.96 -44.77 2 1 GLU A 3 ? ? 52.11 -175.74 3 1 PRO A 13 ? ? -73.60 -169.44 4 1 SER A 14 ? ? -166.77 94.12 5 1 GLN A 21 ? ? 52.29 -174.79 6 1 SER A 23 ? ? -119.80 66.91 7 1 ALA A 24 ? ? -167.40 82.56 8 1 ALA A 25 ? ? 52.59 83.22 9 1 ALA A 28 ? ? -155.63 26.86 10 1 GLU A 29 ? ? 51.77 81.04 11 1 PRO A 30 ? ? -81.97 38.75 12 1 ILE A 32 ? ? -58.04 99.88 13 1 LYS A 41 ? ? -174.67 -46.53 14 1 GLU A 42 ? ? -173.60 -179.20 15 1 ASN A 51 ? ? -115.01 63.42 16 1 LYS A 66 ? ? 68.72 81.30 17 1 SER A 67 ? ? -152.98 -65.40 18 1 THR A 69 ? ? -145.95 -63.91 19 1 LYS A 79 ? ? -59.80 -178.46 20 1 LEU A 81 ? ? -65.07 81.45 21 1 LYS A 82 ? ? -137.98 -155.42 22 1 HIS A 90 ? ? -173.35 -41.55 23 1 ASP A 94 ? ? -179.97 31.69 24 2 ASN A 4 ? ? -161.80 89.77 25 2 GLU A 6 ? ? -165.54 88.36 26 2 SER A 8 ? ? -118.00 -164.56 27 2 ALA A 19 ? ? -132.69 -42.82 28 2 ALA A 20 ? ? -90.16 50.51 29 2 GLN A 21 ? ? -168.87 47.51 30 2 ALA A 26 ? ? -169.16 62.56 31 2 GLU A 29 ? ? -151.95 79.37 32 2 PRO A 30 ? ? -78.77 43.00 33 2 LYS A 41 ? ? -175.61 -42.00 34 2 LYS A 66 ? ? 69.33 81.69 35 2 SER A 67 ? ? -155.04 -75.00 36 2 THR A 69 ? ? -139.99 -62.01 37 2 LEU A 81 ? ? -66.43 83.33 38 2 LYS A 82 ? ? -148.96 -147.07 39 2 HIS A 90 ? ? 176.54 -30.78 40 2 ASP A 94 ? ? 179.71 35.13 41 3 ALA A 2 ? ? -156.30 44.78 42 3 SER A 8 ? ? 52.51 -171.41 43 3 PRO A 13 ? ? -73.26 -82.24 44 3 SER A 14 ? ? -141.01 -71.29 45 3 GLN A 21 ? ? -58.82 -176.11 46 3 ALA A 25 ? ? 51.71 -174.37 47 3 ALA A 28 ? ? -166.23 -54.39 48 3 GLU A 29 ? ? 52.67 71.11 49 3 LYS A 31 ? ? -69.46 67.25 50 3 LYS A 41 ? ? -174.70 -46.86 51 3 GLU A 42 ? ? -170.02 -173.19 52 3 LYS A 66 ? ? 65.91 79.52 53 3 SER A 67 ? ? -153.92 -71.08 54 3 THR A 69 ? ? -153.51 -57.79 55 3 ASP A 70 ? ? -57.49 -70.78 56 3 LEU A 72 ? ? -52.93 106.46 57 3 ILE A 80 ? ? -59.68 88.55 58 3 LEU A 81 ? ? -66.79 86.87 59 3 LYS A 82 ? ? -140.34 -149.74 60 3 HIS A 90 ? ? -171.69 -38.16 61 3 ASP A 94 ? ? -177.68 31.82 62 4 ASN A 4 ? ? -106.49 53.15 63 4 PRO A 13 ? ? -72.88 -163.83 64 4 SER A 14 ? ? 61.54 113.86 65 4 ARG A 15 ? ? -135.62 -49.59 66 4 ALA A 20 ? ? -75.37 -166.84 67 4 SER A 23 ? ? -83.93 -73.09 68 4 ALA A 24 ? ? -168.82 62.88 69 4 GLU A 29 ? ? 51.90 73.09 70 4 PRO A 30 ? ? -81.70 37.87 71 4 ILE A 32 ? ? -58.47 99.51 72 4 GLU A 50 ? ? -36.31 -38.96 73 4 LYS A 66 ? ? 71.81 73.69 74 4 SER A 67 ? ? -160.51 -153.91 75 4 THR A 69 ? ? -148.18 -61.90 76 4 LYS A 79 ? ? -62.02 -176.00 77 4 LEU A 81 ? ? -61.84 92.13 78 4 LYS A 82 ? ? -154.03 -148.16 79 4 HIS A 90 ? ? 178.42 -27.35 80 4 ASP A 94 ? ? 179.83 34.47 81 4 VAL A 101 ? ? -171.38 138.92 82 5 GLU A 3 ? ? -96.21 38.92 83 5 SER A 8 ? ? 54.99 177.50 84 5 PRO A 11 ? ? -73.15 -164.82 85 5 SER A 14 ? ? -134.92 -41.98 86 5 ARG A 15 ? ? 54.94 177.23 87 5 ALA A 18 ? ? 55.77 -85.71 88 5 ALA A 19 ? ? 56.13 174.22 89 5 ALA A 20 ? ? -131.23 -44.15 90 5 GLN A 21 ? ? -141.20 -61.38 91 5 ALA A 28 ? ? -169.92 -48.08 92 5 GLU A 29 ? ? 52.15 82.60 93 5 PRO A 30 ? ? -71.68 -93.53 94 5 LYS A 41 ? ? -177.15 -42.12 95 5 GLU A 42 ? ? -169.70 -169.05 96 5 GLU A 50 ? ? -31.07 -39.10 97 5 ASN A 51 ? ? -92.03 49.50 98 5 LYS A 66 ? ? 72.31 76.02 99 5 SER A 67 ? ? -161.90 -153.73 100 5 THR A 69 ? ? -136.13 -59.69 101 5 ASP A 70 ? ? -56.94 -72.27 102 5 LEU A 81 ? ? -65.23 79.94 103 5 LYS A 82 ? ? -140.55 -156.50 104 5 HIS A 90 ? ? 178.96 -26.47 105 5 ASP A 94 ? ? 179.75 38.02 106 6 ALA A 2 ? ? -151.46 -56.24 107 6 GLU A 3 ? ? 52.27 78.80 108 6 SER A 14 ? ? -142.43 35.30 109 6 ARG A 15 ? ? -165.33 49.97 110 6 ALA A 20 ? ? -142.77 -70.24 111 6 GLN A 21 ? ? -116.53 -70.72 112 6 ALA A 24 ? ? 52.41 87.23 113 6 ALA A 25 ? ? -148.74 -46.07 114 6 ALA A 28 ? ? -162.72 80.77 115 6 GLU A 29 ? ? -161.93 67.07 116 6 LYS A 31 ? ? -69.68 69.21 117 6 GLU A 50 ? ? -36.22 -37.25 118 6 LYS A 66 ? ? 68.72 81.86 119 6 SER A 67 ? ? -157.12 -73.56 120 6 GLN A 68 ? ? -166.45 -165.60 121 6 THR A 69 ? ? -153.19 -51.19 122 6 ASP A 70 ? ? -56.36 -75.31 123 6 LEU A 72 ? ? -55.55 104.24 124 6 LYS A 79 ? ? -59.00 179.54 125 6 LEU A 81 ? ? -65.28 82.44 126 6 HIS A 90 ? ? -178.39 -37.57 127 6 ASP A 94 ? ? -177.87 34.33 128 7 SER A 8 ? ? -62.97 87.08 129 7 SER A 14 ? ? -99.27 35.40 130 7 ARG A 15 ? ? -159.11 -43.54 131 7 ALA A 18 ? ? -130.60 -79.95 132 7 ALA A 19 ? ? -173.98 -75.75 133 7 PRO A 30 ? ? -71.34 -93.64 134 7 LYS A 41 ? ? -175.10 -46.17 135 7 GLU A 42 ? ? -171.32 -176.74 136 7 GLU A 50 ? ? -27.42 -44.61 137 7 ASN A 51 ? ? -85.54 47.38 138 7 LYS A 66 ? ? 74.03 77.75 139 7 SER A 67 ? ? -163.40 -153.59 140 7 GLN A 68 ? ? -68.95 -178.57 141 7 THR A 69 ? ? -146.71 -56.27 142 7 LEU A 72 ? ? -55.43 106.68 143 7 ALA A 77 ? ? -69.52 69.23 144 7 LYS A 79 ? ? -170.21 -174.33 145 7 LEU A 81 ? ? -69.72 72.03 146 7 LYS A 82 ? ? -131.62 -159.71 147 7 HIS A 90 ? ? 175.94 -25.67 148 7 ASP A 94 ? ? -179.01 36.27 149 8 ALA A 2 ? ? -99.29 -158.77 150 8 SER A 7 ? ? -139.24 -64.97 151 8 ALA A 20 ? ? -66.82 83.22 152 8 ALA A 24 ? ? -158.85 66.62 153 8 PRO A 27 ? ? -71.33 -83.69 154 8 PRO A 30 ? ? -73.27 -94.65 155 8 GLU A 42 ? ? -171.92 -165.57 156 8 GLU A 50 ? ? -30.69 -39.78 157 8 ASN A 51 ? ? -91.27 49.56 158 8 SER A 67 ? ? -138.02 -154.11 159 8 ASP A 70 ? ? 40.33 -93.64 160 8 LEU A 72 ? ? 36.18 89.81 161 8 LYS A 79 ? ? -71.62 -164.85 162 8 LEU A 81 ? ? -65.27 86.49 163 8 LYS A 82 ? ? -147.25 -150.25 164 8 HIS A 90 ? ? 178.99 -29.36 165 8 ASP A 94 ? ? 179.84 37.38 166 9 ASN A 4 ? ? -119.65 53.86 167 9 GLU A 6 ? ? 52.62 80.14 168 9 SER A 14 ? ? -159.78 -45.72 169 9 ALA A 19 ? ? -125.23 -56.40 170 9 GLN A 21 ? ? 52.17 89.40 171 9 PRO A 30 ? ? -81.16 30.09 172 9 GLU A 42 ? ? -172.50 -167.23 173 9 GLU A 50 ? ? -37.61 -37.61 174 9 LYS A 66 ? ? 71.70 79.19 175 9 SER A 67 ? ? -131.78 -151.85 176 9 THR A 69 ? ? 66.14 -66.09 177 9 LEU A 72 ? ? -56.21 95.36 178 9 PHE A 76 ? ? -68.74 72.63 179 9 LYS A 79 ? ? -74.21 -161.44 180 9 LEU A 81 ? ? -64.05 89.77 181 9 LYS A 82 ? ? -152.81 -154.30 182 9 HIS A 90 ? ? 178.99 -30.73 183 9 ASP A 94 ? ? -179.50 35.28 184 10 ALA A 2 ? ? -162.21 -166.20 185 10 GLU A 3 ? ? -161.39 87.59 186 10 GLU A 6 ? ? -158.48 72.90 187 10 SER A 7 ? ? -160.33 -72.65 188 10 PRO A 11 ? ? -73.43 -84.20 189 10 ARG A 12 ? ? -156.14 76.87 190 10 ARG A 15 ? ? -166.86 -158.93 191 10 ALA A 18 ? ? -114.34 -165.46 192 10 ALA A 20 ? ? -161.62 90.44 193 10 SER A 23 ? ? -101.75 49.98 194 10 ALA A 25 ? ? 51.98 -170.88 195 10 ALA A 28 ? ? -134.74 -53.12 196 10 LYS A 31 ? ? -68.40 69.75 197 10 ILE A 32 ? ? -58.47 108.70 198 10 GLU A 42 ? ? -172.13 -176.62 199 10 GLU A 50 ? ? -35.32 -39.02 200 10 LYS A 66 ? ? 76.14 85.33 201 10 SER A 67 ? ? -163.47 -154.58 202 10 THR A 69 ? ? -140.88 -53.86 203 10 LYS A 79 ? ? -62.86 -179.40 204 10 LEU A 81 ? ? -59.97 96.63 205 10 LYS A 82 ? ? -160.75 -146.76 206 10 HIS A 90 ? ? 178.03 -29.54 207 10 ASP A 94 ? ? -178.65 35.17 208 11 GLU A 6 ? ? 52.01 85.36 209 11 SER A 14 ? ? -57.37 108.40 210 11 ARG A 15 ? ? -148.63 -63.72 211 11 ALA A 18 ? ? -165.53 -72.48 212 11 ALA A 20 ? ? 52.85 -161.29 213 11 ALA A 24 ? ? -159.45 60.31 214 11 ALA A 28 ? ? -128.48 -60.13 215 11 PRO A 30 ? ? -71.57 -93.20 216 11 GLU A 50 ? ? -39.43 -20.06 217 11 SER A 52 ? ? -96.55 -153.98 218 11 LYS A 66 ? ? 69.60 81.44 219 11 SER A 67 ? ? -168.15 -154.77 220 11 ALA A 77 ? ? 49.20 79.75 221 11 LEU A 81 ? ? -69.50 72.04 222 11 LYS A 82 ? ? -125.95 -160.10 223 11 HIS A 90 ? ? -174.65 -36.61 224 11 ASP A 94 ? ? 179.81 34.09 225 12 SER A 7 ? ? -107.30 52.54 226 12 ALA A 25 ? ? -130.74 -61.55 227 12 GLU A 29 ? ? -177.81 -55.60 228 12 PRO A 30 ? ? -80.51 33.11 229 12 ILE A 32 ? ? -58.33 102.82 230 12 LYS A 41 ? ? -176.71 -38.80 231 12 GLU A 50 ? ? 55.53 -76.67 232 12 SER A 52 ? ? -59.10 92.14 233 12 LYS A 66 ? ? 67.06 81.68 234 12 SER A 67 ? ? -156.04 -65.43 235 12 GLN A 68 ? ? -170.00 -176.15 236 12 THR A 69 ? ? -140.85 -55.08 237 12 LEU A 72 ? ? -53.29 95.75 238 12 LYS A 79 ? ? -60.28 -169.34 239 12 LEU A 81 ? ? -67.09 79.29 240 12 LYS A 82 ? ? -137.15 -158.86 241 12 HIS A 90 ? ? -170.27 -40.68 242 12 ASP A 94 ? ? -179.73 35.85 243 13 GLU A 6 ? ? -138.13 -66.44 244 13 PRO A 17 ? ? -73.02 -167.92 245 13 SER A 23 ? ? -162.20 85.98 246 13 ALA A 26 ? ? -158.47 72.24 247 13 PRO A 30 ? ? -71.87 -93.47 248 13 LYS A 41 ? ? -173.66 -50.12 249 13 GLU A 50 ? ? -37.17 -34.73 250 13 ASN A 51 ? ? -87.15 49.11 251 13 LYS A 66 ? ? 64.23 79.49 252 13 SER A 67 ? ? -154.87 -59.60 253 13 THR A 69 ? ? -143.31 -44.19 254 13 ALA A 77 ? ? -46.94 103.01 255 13 LYS A 79 ? ? -166.65 -166.80 256 13 LEU A 81 ? ? -69.97 71.05 257 13 LYS A 82 ? ? -136.10 -152.65 258 13 HIS A 90 ? ? -172.54 -38.46 259 13 ASP A 94 ? ? -178.49 34.99 260 14 GLU A 3 ? ? -97.36 46.06 261 14 ALA A 18 ? ? 52.65 -164.53 262 14 ALA A 19 ? ? -62.76 -170.72 263 14 ALA A 25 ? ? -102.55 42.87 264 14 GLU A 29 ? ? -177.45 -58.15 265 14 PRO A 30 ? ? -69.32 -92.07 266 14 GLU A 42 ? ? -170.36 -166.52 267 14 LYS A 66 ? ? 69.17 80.66 268 14 SER A 67 ? ? -153.38 -69.84 269 14 THR A 69 ? ? -144.11 -60.04 270 14 LEU A 81 ? ? -67.74 84.29 271 14 LYS A 82 ? ? -153.99 -146.82 272 14 HIS A 90 ? ? -177.94 -31.82 273 14 ASP A 94 ? ? 179.80 35.28 274 14 LEU A 96 ? ? -105.38 -168.99 275 15 SER A 7 ? ? -153.62 -68.08 276 15 ALA A 24 ? ? -167.23 -43.75 277 15 PRO A 30 ? ? -73.46 -93.74 278 15 LYS A 41 ? ? -174.89 -46.75 279 15 ASN A 51 ? ? -86.66 48.70 280 15 LYS A 66 ? ? 70.67 79.97 281 15 SER A 67 ? ? -168.24 -154.40 282 15 THR A 69 ? ? -157.33 -60.67 283 15 ASP A 70 ? ? -60.13 -70.31 284 15 LEU A 72 ? ? -66.71 98.97 285 15 PHE A 76 ? ? -66.96 83.70 286 15 LYS A 79 ? ? -61.86 -175.68 287 15 LEU A 81 ? ? -62.89 86.60 288 15 LYS A 82 ? ? -145.91 -153.13 289 15 HIS A 90 ? ? -176.06 -35.76 290 15 ASP A 94 ? ? 179.96 47.40 291 16 GLU A 6 ? ? -95.53 42.44 292 16 SER A 8 ? ? -108.44 59.04 293 16 ARG A 12 ? ? 179.60 -57.98 294 16 ALA A 18 ? ? -129.62 -163.89 295 16 GLN A 21 ? ? 56.72 171.03 296 16 ALA A 25 ? ? 53.32 88.85 297 16 PRO A 27 ? ? -71.86 -168.68 298 16 GLU A 29 ? ? 52.34 92.60 299 16 PRO A 30 ? ? -71.75 -93.44 300 16 LYS A 41 ? ? -175.67 -39.38 301 16 GLU A 50 ? ? -38.05 -24.47 302 16 SER A 52 ? ? -118.61 -149.87 303 16 LYS A 66 ? ? 73.95 72.54 304 16 GLN A 68 ? ? -74.74 -168.87 305 16 THR A 69 ? ? -151.77 -51.63 306 16 LYS A 79 ? ? -122.58 -167.28 307 16 ILE A 80 ? ? -112.13 79.36 308 16 LEU A 81 ? ? -61.37 89.18 309 16 LYS A 82 ? ? -155.82 -146.67 310 16 HIS A 90 ? ? 179.69 -33.75 311 16 ASP A 94 ? ? 179.88 35.34 312 17 GLU A 3 ? ? 53.10 -178.22 313 17 SER A 7 ? ? -148.91 -54.26 314 17 ARG A 12 ? ? -162.05 76.15 315 17 ARG A 15 ? ? 52.34 90.31 316 17 ALA A 24 ? ? 58.42 165.45 317 17 ALA A 25 ? ? -168.93 87.69 318 17 ALA A 26 ? ? 55.31 175.97 319 17 PRO A 30 ? ? -79.20 41.21 320 17 GLU A 42 ? ? -170.57 -161.62 321 17 GLU A 50 ? ? -25.83 -48.69 322 17 LYS A 66 ? ? 63.76 79.58 323 17 SER A 67 ? ? -155.43 -62.15 324 17 GLN A 68 ? ? -168.52 -165.13 325 17 THR A 69 ? ? -155.11 -44.00 326 17 LEU A 72 ? ? -55.76 100.36 327 17 LYS A 79 ? ? -125.83 -169.77 328 17 LEU A 81 ? ? -62.92 92.03 329 17 LYS A 82 ? ? -153.95 -143.29 330 17 HIS A 90 ? ? 177.83 -27.43 331 17 ASP A 94 ? ? -179.09 36.13 332 18 GLU A 6 ? ? 51.88 -175.62 333 18 ARG A 15 ? ? -94.48 -73.30 334 18 ALA A 20 ? ? -97.43 45.45 335 18 SER A 23 ? ? -154.71 33.20 336 18 ALA A 25 ? ? -157.08 56.02 337 18 PRO A 30 ? ? -82.77 30.00 338 18 LYS A 41 ? ? -177.29 -47.26 339 18 GLU A 42 ? ? -170.13 -177.94 340 18 GLU A 50 ? ? -27.89 -46.66 341 18 LYS A 66 ? ? 63.17 78.16 342 18 SER A 67 ? ? -156.10 -66.59 343 18 THR A 69 ? ? -154.78 -40.93 344 18 LEU A 72 ? ? -56.86 91.57 345 18 PHE A 76 ? ? -69.83 65.78 346 18 LYS A 79 ? ? -77.35 -161.43 347 18 LEU A 81 ? ? -61.84 93.12 348 18 LYS A 82 ? ? -159.16 -150.08 349 18 HIS A 90 ? ? 177.97 -27.45 350 18 ASP A 94 ? ? -179.76 36.42 351 19 ASN A 4 ? ? -67.87 95.38 352 19 PRO A 11 ? ? -73.28 -161.78 353 19 ARG A 15 ? ? 51.96 -170.13 354 19 ALA A 18 ? ? -168.97 117.86 355 19 ALA A 20 ? ? -171.49 83.31 356 19 GLN A 21 ? ? -118.00 -72.40 357 19 ALA A 24 ? ? 53.15 -160.23 358 19 ALA A 28 ? ? -160.97 76.13 359 19 PRO A 30 ? ? -72.68 -92.73 360 19 ILE A 32 ? ? -58.28 100.80 361 19 GLU A 42 ? ? -172.35 -173.14 362 19 ASN A 51 ? ? -78.33 43.40 363 19 LYS A 66 ? ? 68.53 81.33 364 19 SER A 67 ? ? -159.92 -71.78 365 19 THR A 69 ? ? -153.63 -48.19 366 19 LYS A 79 ? ? -59.81 174.17 367 19 LEU A 81 ? ? -65.90 79.67 368 19 HIS A 90 ? ? 178.03 -26.32 369 19 HIS A 93 ? ? -147.03 -48.60 370 19 ASP A 94 ? ? 179.64 35.43 371 20 ALA A 2 ? ? -69.70 -75.60 372 20 GLU A 3 ? ? 52.66 83.26 373 20 SER A 14 ? ? -150.54 -58.56 374 20 ARG A 15 ? ? -108.37 -69.45 375 20 ALA A 18 ? ? 52.20 -171.53 376 20 GLN A 21 ? ? -147.36 -70.00 377 20 ALA A 24 ? ? -155.19 68.60 378 20 ALA A 26 ? ? -163.81 83.85 379 20 ALA A 28 ? ? -116.65 53.41 380 20 PRO A 30 ? ? -72.12 -93.83 381 20 LYS A 41 ? ? -175.21 -42.89 382 20 GLU A 50 ? ? -38.46 -25.03 383 20 ASN A 51 ? ? -113.36 61.25 384 20 SER A 52 ? ? -121.28 -154.12 385 20 LYS A 66 ? ? 71.79 80.62 386 20 SER A 67 ? ? -166.59 -164.50 387 20 THR A 69 ? ? -139.46 -52.67 388 20 LEU A 72 ? ? -51.29 108.01 389 20 PHE A 76 ? ? -69.78 70.64 390 20 ALA A 77 ? ? 28.68 45.50 391 20 LYS A 79 ? ? -105.66 -160.81 392 20 LEU A 81 ? ? -69.73 74.65 393 20 LYS A 82 ? ? -130.29 -159.23 394 20 HIS A 90 ? ? -177.55 -48.93 395 20 ASP A 94 ? ? -178.44 34.37 396 20 LEU A 96 ? ? -109.12 -169.37 397 20 VAL A 101 ? ? -162.39 117.67 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 12 ? ? 0.247 'SIDE CHAIN' 2 1 ARG A 15 ? ? 0.231 'SIDE CHAIN' 3 1 ARG A 64 ? ? 0.220 'SIDE CHAIN' 4 2 ARG A 12 ? ? 0.310 'SIDE CHAIN' 5 2 ARG A 15 ? ? 0.273 'SIDE CHAIN' 6 2 ARG A 64 ? ? 0.214 'SIDE CHAIN' 7 3 ARG A 12 ? ? 0.225 'SIDE CHAIN' 8 3 ARG A 15 ? ? 0.284 'SIDE CHAIN' 9 3 ARG A 64 ? ? 0.272 'SIDE CHAIN' 10 4 ARG A 12 ? ? 0.307 'SIDE CHAIN' 11 4 ARG A 15 ? ? 0.247 'SIDE CHAIN' 12 4 ARG A 64 ? ? 0.309 'SIDE CHAIN' 13 5 ARG A 12 ? ? 0.213 'SIDE CHAIN' 14 5 ARG A 15 ? ? 0.208 'SIDE CHAIN' 15 5 ARG A 64 ? ? 0.233 'SIDE CHAIN' 16 6 ARG A 12 ? ? 0.317 'SIDE CHAIN' 17 6 ARG A 15 ? ? 0.225 'SIDE CHAIN' 18 6 ARG A 64 ? ? 0.316 'SIDE CHAIN' 19 7 ARG A 12 ? ? 0.218 'SIDE CHAIN' 20 7 ARG A 15 ? ? 0.252 'SIDE CHAIN' 21 7 ARG A 64 ? ? 0.313 'SIDE CHAIN' 22 8 ARG A 12 ? ? 0.266 'SIDE CHAIN' 23 8 ARG A 15 ? ? 0.317 'SIDE CHAIN' 24 8 ARG A 64 ? ? 0.227 'SIDE CHAIN' 25 9 ARG A 12 ? ? 0.219 'SIDE CHAIN' 26 9 ARG A 15 ? ? 0.290 'SIDE CHAIN' 27 9 ARG A 64 ? ? 0.316 'SIDE CHAIN' 28 10 ARG A 12 ? ? 0.275 'SIDE CHAIN' 29 10 ARG A 15 ? ? 0.255 'SIDE CHAIN' 30 10 ARG A 64 ? ? 0.235 'SIDE CHAIN' 31 11 ARG A 12 ? ? 0.211 'SIDE CHAIN' 32 11 ARG A 15 ? ? 0.298 'SIDE CHAIN' 33 11 ARG A 64 ? ? 0.310 'SIDE CHAIN' 34 12 ARG A 12 ? ? 0.316 'SIDE CHAIN' 35 12 ARG A 15 ? ? 0.261 'SIDE CHAIN' 36 12 ARG A 64 ? ? 0.306 'SIDE CHAIN' 37 13 ARG A 12 ? ? 0.313 'SIDE CHAIN' 38 13 ARG A 15 ? ? 0.216 'SIDE CHAIN' 39 13 ARG A 64 ? ? 0.316 'SIDE CHAIN' 40 14 ARG A 12 ? ? 0.310 'SIDE CHAIN' 41 14 ARG A 15 ? ? 0.214 'SIDE CHAIN' 42 14 ARG A 64 ? ? 0.293 'SIDE CHAIN' 43 15 ARG A 12 ? ? 0.316 'SIDE CHAIN' 44 15 ARG A 15 ? ? 0.260 'SIDE CHAIN' 45 15 ARG A 64 ? ? 0.211 'SIDE CHAIN' 46 16 ARG A 12 ? ? 0.311 'SIDE CHAIN' 47 16 ARG A 15 ? ? 0.265 'SIDE CHAIN' 48 16 ARG A 64 ? ? 0.303 'SIDE CHAIN' 49 17 ARG A 12 ? ? 0.255 'SIDE CHAIN' 50 17 ARG A 15 ? ? 0.314 'SIDE CHAIN' 51 17 ARG A 64 ? ? 0.265 'SIDE CHAIN' 52 18 ARG A 12 ? ? 0.316 'SIDE CHAIN' 53 18 ARG A 15 ? ? 0.313 'SIDE CHAIN' 54 18 ARG A 64 ? ? 0.277 'SIDE CHAIN' 55 19 ARG A 12 ? ? 0.316 'SIDE CHAIN' 56 19 ARG A 15 ? ? 0.317 'SIDE CHAIN' 57 19 ARG A 64 ? ? 0.240 'SIDE CHAIN' 58 20 ARG A 12 ? ? 0.318 'SIDE CHAIN' 59 20 ARG A 15 ? ? 0.284 'SIDE CHAIN' 60 20 ARG A 64 ? ? 0.232 'SIDE CHAIN' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The C-terminus residues 104-125 were added as linker and his tag for ease of purification. ; # _pdbx_nmr_ensemble.entry_id 1J8C _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1J8C _pdbx_nmr_representative.conformer_id 12 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0 mM protein' _pdbx_nmr_sample_details.solvent_system ;50 mM NaPO4 (pH 6.5) 100 mM NaCl ; # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 3D_15N-separated_NOESY 3 1 1 3D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1J8C _pdbx_nmr_details.text 'This structure was determined by using standard triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1J8C _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'The structures are based on 983 NOE-derived distance restraints, 44 dihedral angle restraints, 23 hydrogen bonds' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 'structure solution' Brunger 1 X-PLOR 3.851 refinement Brunger 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 104 ? A ARG 104 2 1 Y 1 A ASP 105 ? A ASP 105 3 1 Y 1 A PRO 106 ? A PRO 106 4 1 Y 1 A ASN 107 ? A ASN 107 5 1 Y 1 A SER 108 ? A SER 108 6 1 Y 1 A SER 109 ? A SER 109 7 1 Y 1 A SER 110 ? A SER 110 8 1 Y 1 A VAL 111 ? A VAL 111 9 1 Y 1 A ASP 112 ? A ASP 112 10 1 Y 1 A LYS 113 ? A LYS 113 11 1 Y 1 A TYR 114 ? A TYR 114 12 1 Y 1 A ALA 115 ? A ALA 115 13 1 Y 1 A ALA 116 ? A ALA 116 14 1 Y 1 A ALA 117 ? A ALA 117 15 1 Y 1 A LEU 118 ? A LEU 118 16 1 Y 1 A GLU 119 ? A GLU 119 17 1 Y 1 A HIS 120 ? A HIS 120 18 1 Y 1 A HIS 121 ? A HIS 121 19 1 Y 1 A HIS 122 ? A HIS 122 20 1 Y 1 A HIS 123 ? A HIS 123 21 1 Y 1 A HIS 124 ? A HIS 124 22 1 Y 1 A HIS 125 ? A HIS 125 23 2 Y 1 A ARG 104 ? A ARG 104 24 2 Y 1 A ASP 105 ? A ASP 105 25 2 Y 1 A PRO 106 ? A PRO 106 26 2 Y 1 A ASN 107 ? A ASN 107 27 2 Y 1 A SER 108 ? A SER 108 28 2 Y 1 A SER 109 ? A SER 109 29 2 Y 1 A SER 110 ? A SER 110 30 2 Y 1 A VAL 111 ? A VAL 111 31 2 Y 1 A ASP 112 ? A ASP 112 32 2 Y 1 A LYS 113 ? A LYS 113 33 2 Y 1 A TYR 114 ? A TYR 114 34 2 Y 1 A ALA 115 ? A ALA 115 35 2 Y 1 A ALA 116 ? A ALA 116 36 2 Y 1 A ALA 117 ? A ALA 117 37 2 Y 1 A LEU 118 ? A LEU 118 38 2 Y 1 A GLU 119 ? A GLU 119 39 2 Y 1 A HIS 120 ? A HIS 120 40 2 Y 1 A HIS 121 ? A HIS 121 41 2 Y 1 A HIS 122 ? A HIS 122 42 2 Y 1 A HIS 123 ? A HIS 123 43 2 Y 1 A HIS 124 ? A HIS 124 44 2 Y 1 A HIS 125 ? A HIS 125 45 3 Y 1 A ARG 104 ? A ARG 104 46 3 Y 1 A ASP 105 ? A ASP 105 47 3 Y 1 A PRO 106 ? A PRO 106 48 3 Y 1 A ASN 107 ? A ASN 107 49 3 Y 1 A SER 108 ? A SER 108 50 3 Y 1 A SER 109 ? A SER 109 51 3 Y 1 A SER 110 ? A SER 110 52 3 Y 1 A VAL 111 ? A VAL 111 53 3 Y 1 A ASP 112 ? A ASP 112 54 3 Y 1 A LYS 113 ? A LYS 113 55 3 Y 1 A TYR 114 ? A TYR 114 56 3 Y 1 A ALA 115 ? A ALA 115 57 3 Y 1 A ALA 116 ? A ALA 116 58 3 Y 1 A ALA 117 ? A ALA 117 59 3 Y 1 A LEU 118 ? A LEU 118 60 3 Y 1 A GLU 119 ? A GLU 119 61 3 Y 1 A HIS 120 ? A HIS 120 62 3 Y 1 A HIS 121 ? A HIS 121 63 3 Y 1 A HIS 122 ? A HIS 122 64 3 Y 1 A HIS 123 ? A HIS 123 65 3 Y 1 A HIS 124 ? A HIS 124 66 3 Y 1 A HIS 125 ? A HIS 125 67 4 Y 1 A ARG 104 ? A ARG 104 68 4 Y 1 A ASP 105 ? A ASP 105 69 4 Y 1 A PRO 106 ? A PRO 106 70 4 Y 1 A ASN 107 ? A ASN 107 71 4 Y 1 A SER 108 ? A SER 108 72 4 Y 1 A SER 109 ? A SER 109 73 4 Y 1 A SER 110 ? A SER 110 74 4 Y 1 A VAL 111 ? A VAL 111 75 4 Y 1 A ASP 112 ? A ASP 112 76 4 Y 1 A LYS 113 ? A LYS 113 77 4 Y 1 A TYR 114 ? A TYR 114 78 4 Y 1 A ALA 115 ? A ALA 115 79 4 Y 1 A ALA 116 ? A ALA 116 80 4 Y 1 A ALA 117 ? A ALA 117 81 4 Y 1 A LEU 118 ? A LEU 118 82 4 Y 1 A GLU 119 ? A GLU 119 83 4 Y 1 A HIS 120 ? A HIS 120 84 4 Y 1 A HIS 121 ? A HIS 121 85 4 Y 1 A HIS 122 ? A HIS 122 86 4 Y 1 A HIS 123 ? A HIS 123 87 4 Y 1 A HIS 124 ? A HIS 124 88 4 Y 1 A HIS 125 ? A HIS 125 89 5 Y 1 A ARG 104 ? A ARG 104 90 5 Y 1 A ASP 105 ? A ASP 105 91 5 Y 1 A PRO 106 ? A PRO 106 92 5 Y 1 A ASN 107 ? A ASN 107 93 5 Y 1 A SER 108 ? A SER 108 94 5 Y 1 A SER 109 ? A SER 109 95 5 Y 1 A SER 110 ? A SER 110 96 5 Y 1 A VAL 111 ? A VAL 111 97 5 Y 1 A ASP 112 ? A ASP 112 98 5 Y 1 A LYS 113 ? A LYS 113 99 5 Y 1 A TYR 114 ? A TYR 114 100 5 Y 1 A ALA 115 ? A ALA 115 101 5 Y 1 A ALA 116 ? A ALA 116 102 5 Y 1 A ALA 117 ? A ALA 117 103 5 Y 1 A LEU 118 ? A LEU 118 104 5 Y 1 A GLU 119 ? A GLU 119 105 5 Y 1 A HIS 120 ? A HIS 120 106 5 Y 1 A HIS 121 ? A HIS 121 107 5 Y 1 A HIS 122 ? A HIS 122 108 5 Y 1 A HIS 123 ? A HIS 123 109 5 Y 1 A HIS 124 ? A HIS 124 110 5 Y 1 A HIS 125 ? A HIS 125 111 6 Y 1 A ARG 104 ? A ARG 104 112 6 Y 1 A ASP 105 ? A ASP 105 113 6 Y 1 A PRO 106 ? A PRO 106 114 6 Y 1 A ASN 107 ? A ASN 107 115 6 Y 1 A SER 108 ? A SER 108 116 6 Y 1 A SER 109 ? A SER 109 117 6 Y 1 A SER 110 ? A SER 110 118 6 Y 1 A VAL 111 ? A VAL 111 119 6 Y 1 A ASP 112 ? A ASP 112 120 6 Y 1 A LYS 113 ? A LYS 113 121 6 Y 1 A TYR 114 ? A TYR 114 122 6 Y 1 A ALA 115 ? A ALA 115 123 6 Y 1 A ALA 116 ? A ALA 116 124 6 Y 1 A ALA 117 ? A ALA 117 125 6 Y 1 A LEU 118 ? A LEU 118 126 6 Y 1 A GLU 119 ? A GLU 119 127 6 Y 1 A HIS 120 ? A HIS 120 128 6 Y 1 A HIS 121 ? A HIS 121 129 6 Y 1 A HIS 122 ? A HIS 122 130 6 Y 1 A HIS 123 ? A HIS 123 131 6 Y 1 A HIS 124 ? A HIS 124 132 6 Y 1 A HIS 125 ? A HIS 125 133 7 Y 1 A ARG 104 ? A ARG 104 134 7 Y 1 A ASP 105 ? A ASP 105 135 7 Y 1 A PRO 106 ? A PRO 106 136 7 Y 1 A ASN 107 ? A ASN 107 137 7 Y 1 A SER 108 ? A SER 108 138 7 Y 1 A SER 109 ? A SER 109 139 7 Y 1 A SER 110 ? A SER 110 140 7 Y 1 A VAL 111 ? A VAL 111 141 7 Y 1 A ASP 112 ? A ASP 112 142 7 Y 1 A LYS 113 ? A LYS 113 143 7 Y 1 A TYR 114 ? A TYR 114 144 7 Y 1 A ALA 115 ? A ALA 115 145 7 Y 1 A ALA 116 ? A ALA 116 146 7 Y 1 A ALA 117 ? A ALA 117 147 7 Y 1 A LEU 118 ? A LEU 118 148 7 Y 1 A GLU 119 ? A GLU 119 149 7 Y 1 A HIS 120 ? A HIS 120 150 7 Y 1 A HIS 121 ? A HIS 121 151 7 Y 1 A HIS 122 ? A HIS 122 152 7 Y 1 A HIS 123 ? A HIS 123 153 7 Y 1 A HIS 124 ? A HIS 124 154 7 Y 1 A HIS 125 ? A HIS 125 155 8 Y 1 A ARG 104 ? A ARG 104 156 8 Y 1 A ASP 105 ? A ASP 105 157 8 Y 1 A PRO 106 ? A PRO 106 158 8 Y 1 A ASN 107 ? A ASN 107 159 8 Y 1 A SER 108 ? A SER 108 160 8 Y 1 A SER 109 ? A SER 109 161 8 Y 1 A SER 110 ? A SER 110 162 8 Y 1 A VAL 111 ? A VAL 111 163 8 Y 1 A ASP 112 ? A ASP 112 164 8 Y 1 A LYS 113 ? A LYS 113 165 8 Y 1 A TYR 114 ? A TYR 114 166 8 Y 1 A ALA 115 ? A ALA 115 167 8 Y 1 A ALA 116 ? A ALA 116 168 8 Y 1 A ALA 117 ? A ALA 117 169 8 Y 1 A LEU 118 ? A LEU 118 170 8 Y 1 A GLU 119 ? A GLU 119 171 8 Y 1 A HIS 120 ? A HIS 120 172 8 Y 1 A HIS 121 ? A HIS 121 173 8 Y 1 A HIS 122 ? A HIS 122 174 8 Y 1 A HIS 123 ? A HIS 123 175 8 Y 1 A HIS 124 ? A HIS 124 176 8 Y 1 A HIS 125 ? A HIS 125 177 9 Y 1 A ARG 104 ? A ARG 104 178 9 Y 1 A ASP 105 ? A ASP 105 179 9 Y 1 A PRO 106 ? A PRO 106 180 9 Y 1 A ASN 107 ? A ASN 107 181 9 Y 1 A SER 108 ? A SER 108 182 9 Y 1 A SER 109 ? A SER 109 183 9 Y 1 A SER 110 ? A SER 110 184 9 Y 1 A VAL 111 ? A VAL 111 185 9 Y 1 A ASP 112 ? A ASP 112 186 9 Y 1 A LYS 113 ? A LYS 113 187 9 Y 1 A TYR 114 ? A TYR 114 188 9 Y 1 A ALA 115 ? A ALA 115 189 9 Y 1 A ALA 116 ? A ALA 116 190 9 Y 1 A ALA 117 ? A ALA 117 191 9 Y 1 A LEU 118 ? A LEU 118 192 9 Y 1 A GLU 119 ? A GLU 119 193 9 Y 1 A HIS 120 ? A HIS 120 194 9 Y 1 A HIS 121 ? A HIS 121 195 9 Y 1 A HIS 122 ? A HIS 122 196 9 Y 1 A HIS 123 ? A HIS 123 197 9 Y 1 A HIS 124 ? A HIS 124 198 9 Y 1 A HIS 125 ? A HIS 125 199 10 Y 1 A ARG 104 ? A ARG 104 200 10 Y 1 A ASP 105 ? A ASP 105 201 10 Y 1 A PRO 106 ? A PRO 106 202 10 Y 1 A ASN 107 ? A ASN 107 203 10 Y 1 A SER 108 ? A SER 108 204 10 Y 1 A SER 109 ? A SER 109 205 10 Y 1 A SER 110 ? A SER 110 206 10 Y 1 A VAL 111 ? A VAL 111 207 10 Y 1 A ASP 112 ? A ASP 112 208 10 Y 1 A LYS 113 ? A LYS 113 209 10 Y 1 A TYR 114 ? A TYR 114 210 10 Y 1 A ALA 115 ? A ALA 115 211 10 Y 1 A ALA 116 ? A ALA 116 212 10 Y 1 A ALA 117 ? A ALA 117 213 10 Y 1 A LEU 118 ? A LEU 118 214 10 Y 1 A GLU 119 ? A GLU 119 215 10 Y 1 A HIS 120 ? A HIS 120 216 10 Y 1 A HIS 121 ? A HIS 121 217 10 Y 1 A HIS 122 ? A HIS 122 218 10 Y 1 A HIS 123 ? A HIS 123 219 10 Y 1 A HIS 124 ? A HIS 124 220 10 Y 1 A HIS 125 ? A HIS 125 221 11 Y 1 A ARG 104 ? A ARG 104 222 11 Y 1 A ASP 105 ? A ASP 105 223 11 Y 1 A PRO 106 ? A PRO 106 224 11 Y 1 A ASN 107 ? A ASN 107 225 11 Y 1 A SER 108 ? A SER 108 226 11 Y 1 A SER 109 ? A SER 109 227 11 Y 1 A SER 110 ? A SER 110 228 11 Y 1 A VAL 111 ? A VAL 111 229 11 Y 1 A ASP 112 ? A ASP 112 230 11 Y 1 A LYS 113 ? A LYS 113 231 11 Y 1 A TYR 114 ? A TYR 114 232 11 Y 1 A ALA 115 ? A ALA 115 233 11 Y 1 A ALA 116 ? A ALA 116 234 11 Y 1 A ALA 117 ? A ALA 117 235 11 Y 1 A LEU 118 ? A LEU 118 236 11 Y 1 A GLU 119 ? A GLU 119 237 11 Y 1 A HIS 120 ? A HIS 120 238 11 Y 1 A HIS 121 ? A HIS 121 239 11 Y 1 A HIS 122 ? A HIS 122 240 11 Y 1 A HIS 123 ? A HIS 123 241 11 Y 1 A HIS 124 ? A HIS 124 242 11 Y 1 A HIS 125 ? A HIS 125 243 12 Y 1 A ARG 104 ? A ARG 104 244 12 Y 1 A ASP 105 ? A ASP 105 245 12 Y 1 A PRO 106 ? A PRO 106 246 12 Y 1 A ASN 107 ? A ASN 107 247 12 Y 1 A SER 108 ? A SER 108 248 12 Y 1 A SER 109 ? A SER 109 249 12 Y 1 A SER 110 ? A SER 110 250 12 Y 1 A VAL 111 ? A VAL 111 251 12 Y 1 A ASP 112 ? A ASP 112 252 12 Y 1 A LYS 113 ? A LYS 113 253 12 Y 1 A TYR 114 ? A TYR 114 254 12 Y 1 A ALA 115 ? A ALA 115 255 12 Y 1 A ALA 116 ? A ALA 116 256 12 Y 1 A ALA 117 ? A ALA 117 257 12 Y 1 A LEU 118 ? A LEU 118 258 12 Y 1 A GLU 119 ? A GLU 119 259 12 Y 1 A HIS 120 ? A HIS 120 260 12 Y 1 A HIS 121 ? A HIS 121 261 12 Y 1 A HIS 122 ? A HIS 122 262 12 Y 1 A HIS 123 ? A HIS 123 263 12 Y 1 A HIS 124 ? A HIS 124 264 12 Y 1 A HIS 125 ? A HIS 125 265 13 Y 1 A ARG 104 ? A ARG 104 266 13 Y 1 A ASP 105 ? A ASP 105 267 13 Y 1 A PRO 106 ? A PRO 106 268 13 Y 1 A ASN 107 ? A ASN 107 269 13 Y 1 A SER 108 ? A SER 108 270 13 Y 1 A SER 109 ? A SER 109 271 13 Y 1 A SER 110 ? A SER 110 272 13 Y 1 A VAL 111 ? A VAL 111 273 13 Y 1 A ASP 112 ? A ASP 112 274 13 Y 1 A LYS 113 ? A LYS 113 275 13 Y 1 A TYR 114 ? A TYR 114 276 13 Y 1 A ALA 115 ? A ALA 115 277 13 Y 1 A ALA 116 ? A ALA 116 278 13 Y 1 A ALA 117 ? A ALA 117 279 13 Y 1 A LEU 118 ? A LEU 118 280 13 Y 1 A GLU 119 ? A GLU 119 281 13 Y 1 A HIS 120 ? A HIS 120 282 13 Y 1 A HIS 121 ? A HIS 121 283 13 Y 1 A HIS 122 ? A HIS 122 284 13 Y 1 A HIS 123 ? A HIS 123 285 13 Y 1 A HIS 124 ? A HIS 124 286 13 Y 1 A HIS 125 ? A HIS 125 287 14 Y 1 A ARG 104 ? A ARG 104 288 14 Y 1 A ASP 105 ? A ASP 105 289 14 Y 1 A PRO 106 ? A PRO 106 290 14 Y 1 A ASN 107 ? A ASN 107 291 14 Y 1 A SER 108 ? A SER 108 292 14 Y 1 A SER 109 ? A SER 109 293 14 Y 1 A SER 110 ? A SER 110 294 14 Y 1 A VAL 111 ? A VAL 111 295 14 Y 1 A ASP 112 ? A ASP 112 296 14 Y 1 A LYS 113 ? A LYS 113 297 14 Y 1 A TYR 114 ? A TYR 114 298 14 Y 1 A ALA 115 ? A ALA 115 299 14 Y 1 A ALA 116 ? A ALA 116 300 14 Y 1 A ALA 117 ? A ALA 117 301 14 Y 1 A LEU 118 ? A LEU 118 302 14 Y 1 A GLU 119 ? A GLU 119 303 14 Y 1 A HIS 120 ? A HIS 120 304 14 Y 1 A HIS 121 ? A HIS 121 305 14 Y 1 A HIS 122 ? A HIS 122 306 14 Y 1 A HIS 123 ? A HIS 123 307 14 Y 1 A HIS 124 ? A HIS 124 308 14 Y 1 A HIS 125 ? A HIS 125 309 15 Y 1 A ARG 104 ? A ARG 104 310 15 Y 1 A ASP 105 ? A ASP 105 311 15 Y 1 A PRO 106 ? A PRO 106 312 15 Y 1 A ASN 107 ? A ASN 107 313 15 Y 1 A SER 108 ? A SER 108 314 15 Y 1 A SER 109 ? A SER 109 315 15 Y 1 A SER 110 ? A SER 110 316 15 Y 1 A VAL 111 ? A VAL 111 317 15 Y 1 A ASP 112 ? A ASP 112 318 15 Y 1 A LYS 113 ? A LYS 113 319 15 Y 1 A TYR 114 ? A TYR 114 320 15 Y 1 A ALA 115 ? A ALA 115 321 15 Y 1 A ALA 116 ? A ALA 116 322 15 Y 1 A ALA 117 ? A ALA 117 323 15 Y 1 A LEU 118 ? A LEU 118 324 15 Y 1 A GLU 119 ? A GLU 119 325 15 Y 1 A HIS 120 ? A HIS 120 326 15 Y 1 A HIS 121 ? A HIS 121 327 15 Y 1 A HIS 122 ? A HIS 122 328 15 Y 1 A HIS 123 ? A HIS 123 329 15 Y 1 A HIS 124 ? A HIS 124 330 15 Y 1 A HIS 125 ? A HIS 125 331 16 Y 1 A ARG 104 ? A ARG 104 332 16 Y 1 A ASP 105 ? A ASP 105 333 16 Y 1 A PRO 106 ? A PRO 106 334 16 Y 1 A ASN 107 ? A ASN 107 335 16 Y 1 A SER 108 ? A SER 108 336 16 Y 1 A SER 109 ? A SER 109 337 16 Y 1 A SER 110 ? A SER 110 338 16 Y 1 A VAL 111 ? A VAL 111 339 16 Y 1 A ASP 112 ? A ASP 112 340 16 Y 1 A LYS 113 ? A LYS 113 341 16 Y 1 A TYR 114 ? A TYR 114 342 16 Y 1 A ALA 115 ? A ALA 115 343 16 Y 1 A ALA 116 ? A ALA 116 344 16 Y 1 A ALA 117 ? A ALA 117 345 16 Y 1 A LEU 118 ? A LEU 118 346 16 Y 1 A GLU 119 ? A GLU 119 347 16 Y 1 A HIS 120 ? A HIS 120 348 16 Y 1 A HIS 121 ? A HIS 121 349 16 Y 1 A HIS 122 ? A HIS 122 350 16 Y 1 A HIS 123 ? A HIS 123 351 16 Y 1 A HIS 124 ? A HIS 124 352 16 Y 1 A HIS 125 ? A HIS 125 353 17 Y 1 A ARG 104 ? A ARG 104 354 17 Y 1 A ASP 105 ? A ASP 105 355 17 Y 1 A PRO 106 ? A PRO 106 356 17 Y 1 A ASN 107 ? A ASN 107 357 17 Y 1 A SER 108 ? A SER 108 358 17 Y 1 A SER 109 ? A SER 109 359 17 Y 1 A SER 110 ? A SER 110 360 17 Y 1 A VAL 111 ? A VAL 111 361 17 Y 1 A ASP 112 ? A ASP 112 362 17 Y 1 A LYS 113 ? A LYS 113 363 17 Y 1 A TYR 114 ? A TYR 114 364 17 Y 1 A ALA 115 ? A ALA 115 365 17 Y 1 A ALA 116 ? A ALA 116 366 17 Y 1 A ALA 117 ? A ALA 117 367 17 Y 1 A LEU 118 ? A LEU 118 368 17 Y 1 A GLU 119 ? A GLU 119 369 17 Y 1 A HIS 120 ? A HIS 120 370 17 Y 1 A HIS 121 ? A HIS 121 371 17 Y 1 A HIS 122 ? A HIS 122 372 17 Y 1 A HIS 123 ? A HIS 123 373 17 Y 1 A HIS 124 ? A HIS 124 374 17 Y 1 A HIS 125 ? A HIS 125 375 18 Y 1 A ARG 104 ? A ARG 104 376 18 Y 1 A ASP 105 ? A ASP 105 377 18 Y 1 A PRO 106 ? A PRO 106 378 18 Y 1 A ASN 107 ? A ASN 107 379 18 Y 1 A SER 108 ? A SER 108 380 18 Y 1 A SER 109 ? A SER 109 381 18 Y 1 A SER 110 ? A SER 110 382 18 Y 1 A VAL 111 ? A VAL 111 383 18 Y 1 A ASP 112 ? A ASP 112 384 18 Y 1 A LYS 113 ? A LYS 113 385 18 Y 1 A TYR 114 ? A TYR 114 386 18 Y 1 A ALA 115 ? A ALA 115 387 18 Y 1 A ALA 116 ? A ALA 116 388 18 Y 1 A ALA 117 ? A ALA 117 389 18 Y 1 A LEU 118 ? A LEU 118 390 18 Y 1 A GLU 119 ? A GLU 119 391 18 Y 1 A HIS 120 ? A HIS 120 392 18 Y 1 A HIS 121 ? A HIS 121 393 18 Y 1 A HIS 122 ? A HIS 122 394 18 Y 1 A HIS 123 ? A HIS 123 395 18 Y 1 A HIS 124 ? A HIS 124 396 18 Y 1 A HIS 125 ? A HIS 125 397 19 Y 1 A ARG 104 ? A ARG 104 398 19 Y 1 A ASP 105 ? A ASP 105 399 19 Y 1 A PRO 106 ? A PRO 106 400 19 Y 1 A ASN 107 ? A ASN 107 401 19 Y 1 A SER 108 ? A SER 108 402 19 Y 1 A SER 109 ? A SER 109 403 19 Y 1 A SER 110 ? A SER 110 404 19 Y 1 A VAL 111 ? A VAL 111 405 19 Y 1 A ASP 112 ? A ASP 112 406 19 Y 1 A LYS 113 ? A LYS 113 407 19 Y 1 A TYR 114 ? A TYR 114 408 19 Y 1 A ALA 115 ? A ALA 115 409 19 Y 1 A ALA 116 ? A ALA 116 410 19 Y 1 A ALA 117 ? A ALA 117 411 19 Y 1 A LEU 118 ? A LEU 118 412 19 Y 1 A GLU 119 ? A GLU 119 413 19 Y 1 A HIS 120 ? A HIS 120 414 19 Y 1 A HIS 121 ? A HIS 121 415 19 Y 1 A HIS 122 ? A HIS 122 416 19 Y 1 A HIS 123 ? A HIS 123 417 19 Y 1 A HIS 124 ? A HIS 124 418 19 Y 1 A HIS 125 ? A HIS 125 419 20 Y 1 A ARG 104 ? A ARG 104 420 20 Y 1 A ASP 105 ? A ASP 105 421 20 Y 1 A PRO 106 ? A PRO 106 422 20 Y 1 A ASN 107 ? A ASN 107 423 20 Y 1 A SER 108 ? A SER 108 424 20 Y 1 A SER 109 ? A SER 109 425 20 Y 1 A SER 110 ? A SER 110 426 20 Y 1 A VAL 111 ? A VAL 111 427 20 Y 1 A ASP 112 ? A ASP 112 428 20 Y 1 A LYS 113 ? A LYS 113 429 20 Y 1 A TYR 114 ? A TYR 114 430 20 Y 1 A ALA 115 ? A ALA 115 431 20 Y 1 A ALA 116 ? A ALA 116 432 20 Y 1 A ALA 117 ? A ALA 117 433 20 Y 1 A LEU 118 ? A LEU 118 434 20 Y 1 A GLU 119 ? A GLU 119 435 20 Y 1 A HIS 120 ? A HIS 120 436 20 Y 1 A HIS 121 ? A HIS 121 437 20 Y 1 A HIS 122 ? A HIS 122 438 20 Y 1 A HIS 123 ? A HIS 123 439 20 Y 1 A HIS 124 ? A HIS 124 440 20 Y 1 A HIS 125 ? A HIS 125 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Varian INOVA 500 # _atom_sites.entry_id 1J8C _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_