data_1J98
# 
_entry.id   1J98 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1J98         pdb_00001j98 10.2210/pdb1j98/pdb 
RCSB  RCSB013518   ?            ?                   
WWPDB D_1000013518 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J98 
_pdbx_database_status.recvd_initial_deposition_date   2001-05-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ruzheinikov, S.N.' 1  
'Das, S.K.'         2  
'Sedelnikova, S.E.' 3  
'Hartley, A.'       4  
'Foster, S.J.'      5  
'Horsburgh, M.J.'   6  
'Cox, A.G.'         7  
'McCleod, C.W.'     8  
'Mekhalfia, A.'     9  
'Blackburn, G.M.'   10 
'Rice, D.W.'        11 
'Baker, P.J.'       12 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The 1.2 A Structure of a Novel Quorum-Sensing Protein, Bacillus subtilis LuxS'                              J.Mol.Biol. 
313 111  122  2001 JMOBAK UK 0022-2836 0070 ? 11601850 10.1006/jmbi.2001.5027    
1       'Cloning, Purification, Crystallization and Preliminary Crystallographic Analysis of Bacillus subtilis LuxS' 
'Acta Crystallogr.,Sect.D' 57  1324 1325 2001 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444901011611 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ruzheinikov, S.N.' 1  ? 
primary 'Das, S.K.'         2  ? 
primary 'Sedelnikova, S.E.' 3  ? 
primary 'Hartley, A.'       4  ? 
primary 'Foster, S.J.'      5  ? 
primary 'Horsburgh, M.J.'   6  ? 
primary 'Cox, A.G.'         7  ? 
primary 'McCleod, C.W.'     8  ? 
primary 'Mekhalfia, A.'     9  ? 
primary 'Blackburn, G.M.'   10 ? 
primary 'Rice, D.W.'        11 ? 
primary 'Baker, P.J.'       12 ? 
1       'Das, S.K.'         13 ? 
1       'Sedelnikova, S.E.' 14 ? 
1       'Baker, P.J.'       15 ? 
1       'Ruzheinikov, S.N.' 16 ? 
1       'Foster, S.J.'      17 ? 
1       'Hartley, A.'       18 ? 
1       'Horsburgh, M.J.'   19 ? 
1       'Rice, D.W.'        20 ? 
# 
_cell.entry_id           1J98 
_cell.length_a           62.780 
_cell.length_b           62.780 
_cell.length_c           149.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J98 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'AUTOINDUCER-2 PRODUCTION PROTEIN LUXS' 17790.219 1   ? P96T ? ? 
2 non-polymer syn 'ZINC ION'                              65.409    1   ? ?    ? ? 
3 water       nat water                                   18.015    217 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AI-2 SYNTHESIS PROTEIN' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMG(OCS)QTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVF
G
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMGCQTGYYLVVSGETTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   VAL n 
1 5   GLU n 
1 6   SER n 
1 7   PHE n 
1 8   GLU n 
1 9   LEU n 
1 10  ASP n 
1 11  HIS n 
1 12  ASN n 
1 13  ALA n 
1 14  VAL n 
1 15  VAL n 
1 16  ALA n 
1 17  PRO n 
1 18  TYR n 
1 19  VAL n 
1 20  ARG n 
1 21  HIS n 
1 22  CYS n 
1 23  GLY n 
1 24  VAL n 
1 25  HIS n 
1 26  LYS n 
1 27  VAL n 
1 28  GLY n 
1 29  THR n 
1 30  ASP n 
1 31  GLY n 
1 32  VAL n 
1 33  VAL n 
1 34  ASN n 
1 35  LYS n 
1 36  PHE n 
1 37  ASP n 
1 38  ILE n 
1 39  ARG n 
1 40  PHE n 
1 41  CYS n 
1 42  GLN n 
1 43  PRO n 
1 44  ASN n 
1 45  LYS n 
1 46  GLN n 
1 47  ALA n 
1 48  MET n 
1 49  LYS n 
1 50  PRO n 
1 51  ASP n 
1 52  THR n 
1 53  ILE n 
1 54  HIS n 
1 55  THR n 
1 56  LEU n 
1 57  GLU n 
1 58  HIS n 
1 59  LEU n 
1 60  LEU n 
1 61  ALA n 
1 62  PHE n 
1 63  THR n 
1 64  ILE n 
1 65  ARG n 
1 66  SER n 
1 67  HIS n 
1 68  ALA n 
1 69  GLU n 
1 70  LYS n 
1 71  TYR n 
1 72  ASP n 
1 73  HIS n 
1 74  PHE n 
1 75  ASP n 
1 76  ILE n 
1 77  ILE n 
1 78  ASP n 
1 79  ILE n 
1 80  SER n 
1 81  PRO n 
1 82  MET n 
1 83  GLY n 
1 84  OCS n 
1 85  GLN n 
1 86  THR n 
1 87  GLY n 
1 88  TYR n 
1 89  TYR n 
1 90  LEU n 
1 91  VAL n 
1 92  VAL n 
1 93  SER n 
1 94  GLY n 
1 95  GLU n 
1 96  THR n 
1 97  THR n 
1 98  SER n 
1 99  ALA n 
1 100 GLU n 
1 101 ILE n 
1 102 VAL n 
1 103 ASP n 
1 104 LEU n 
1 105 LEU n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 MET n 
1 110 LYS n 
1 111 GLU n 
1 112 ALA n 
1 113 VAL n 
1 114 GLU n 
1 115 ILE n 
1 116 THR n 
1 117 GLU n 
1 118 ILE n 
1 119 PRO n 
1 120 ALA n 
1 121 ALA n 
1 122 ASN n 
1 123 GLU n 
1 124 LYS n 
1 125 GLN n 
1 126 CYS n 
1 127 GLY n 
1 128 GLN n 
1 129 ALA n 
1 130 LYS n 
1 131 LEU n 
1 132 HIS n 
1 133 ASP n 
1 134 LEU n 
1 135 GLU n 
1 136 GLY n 
1 137 ALA n 
1 138 LYS n 
1 139 ARG n 
1 140 LEU n 
1 141 MET n 
1 142 ARG n 
1 143 PHE n 
1 144 TRP n 
1 145 LEU n 
1 146 SER n 
1 147 GLN n 
1 148 ASP n 
1 149 LYS n 
1 150 GLU n 
1 151 GLU n 
1 152 LEU n 
1 153 LEU n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LUXS_BACSU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O34667 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLLAFTIRSHAEKYDHFDIIDIS
PMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPAANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1J98 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 157 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O34667 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  157 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       157 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1J98 OCS A 84 ? UNP O34667 CYS 84 'modified residue'    84 1 
1 1J98 THR A 96 ? UNP O34667 PRO 96 'engineered mutation' 96 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
OCS 'L-peptide linking' n 'CYSTEINESULFONIC ACID' ? 'C3 H7 N O5 S'   169.156 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'              ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1J98 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   39.56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'1.8 - 2.4M Ammonium sulphate, 0.1M Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-04-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9780 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9780 
# 
_reflns.entry_id                     1J98 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             10.0 
_reflns.d_resolution_high            1.20 
_reflns.number_obs                   53328 
_reflns.number_all                   53328 
_reflns.percent_possible_obs         96.5 
_reflns.pdbx_Rmerge_I_obs            0.0480000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        32.9 
_reflns.B_iso_Wilson_estimate        13.6 
_reflns.pdbx_redundancy              5.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.20 
_reflns_shell.d_res_low              1.22 
_reflns_shell.percent_possible_all   63.3 
_reflns_shell.Rmerge_I_obs           0.2570000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1714 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1J98 
_refine.ls_number_reflns_obs                     50614 
_refine.ls_number_reflns_all                     50614 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.2 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          0.1270000 
_refine.ls_R_factor_all                          0.1270000 
_refine.ls_R_factor_R_work                       0.1260000 
_refine.ls_R_factor_R_free                       0.1460000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2714 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               16.8 
_refine.aniso_B[1][1]                            0.78 
_refine.aniso_B[2][2]                            0.78 
_refine.aniso_B[3][3]                            -1.18 
_refine.aniso_B[1][2]                            0.39 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.031 
_refine.overall_SU_B                             1.056 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            0.025 
_refine.pdbx_overall_ESU_R                       0.031 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1J98 
_refine_analyze.Luzzati_coordinate_error_obs    0.031 
_refine_analyze.Luzzati_sigma_a_obs             0.025 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.031 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1225 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             217 
_refine_hist.number_atoms_total               1443 
_refine_hist.d_res_high                       1.2 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d       0.012  ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d      1.563  ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr 0.110  ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it    4.245  ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it   6.065  ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it    9.269  ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it   11.793 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1J98 
_struct.title                     'The 1.2 Angstrom Structure of Bacillus subtilis LuxS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J98 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Autoinducer synthesis, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The second part of the biological assembly is generated 
by the two fold axis:  x, x-y, 5/6-z.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 4   ? LEU A 9   ? VAL A 4   LEU A 9   5 ? 6  
HELX_P HELX_P2 2 LYS A 49  ? GLU A 69  ? LYS A 49  GLU A 69  1 ? 21 
HELX_P HELX_P3 3 THR A 97  ? VAL A 113 ? THR A 97  VAL A 113 1 ? 17 
HELX_P HELX_P4 4 ASP A 133 ? SER A 146 ? ASP A 133 SER A 146 1 ? 14 
HELX_P HELX_P5 5 ASP A 148 ? LEU A 153 ? ASP A 148 LEU A 153 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A GLY 83  C   ? ? ? 1_555 A OCS 84 N  ? ? A GLY 83  A OCS 84  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale2 covale both ? A OCS 84  C   ? ? ? 1_555 A GLN 85 N  ? ? A OCS 84  A GLN 85  1_555 ? ? ? ? ? ? ? 1.333 ? ? 
metalc1 metalc ?    ? A HIS 54  NE2 ? ? ? 1_555 B ZN  .  ZN ? ? A HIS 54  A ZN  300 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc2 metalc ?    ? A HIS 58  NE2 ? ? ? 1_555 B ZN  .  ZN ? ? A HIS 58  A ZN  300 1_555 ? ? ? ? ? ? ? 2.056 ? ? 
metalc3 metalc ?    ? A CYS 126 SG  ? ? ? 1_555 B ZN  .  ZN ? ? A CYS 126 A ZN  300 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc4 metalc ?    ? B ZN  .   ZN  ? ? ? 1_555 C HOH .  O  ? ? A ZN  300 A HOH 395 1_555 ? ? ? ? ? ? ? 2.082 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           16 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            16 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    17 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     17 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -7.33 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 18 ? VAL A 27 ? TYR A 18 VAL A 27 
A 2 GLY A 31 ? ARG A 39 ? GLY A 31 ARG A 39 
A 3 GLY A 87 ? GLY A 94 ? GLY A 87 GLY A 94 
A 4 PHE A 74 ? PRO A 81 ? PHE A 74 PRO A 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 27 ? N VAL A 27 O GLY A 31 ? O GLY A 31 
A 2 3 N ILE A 38 ? N ILE A 38 O TYR A 88 ? O TYR A 88 
A 3 4 N SER A 93 ? N SER A 93 O ASP A 75 ? O ASP A 75 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     300 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 54  ? HIS A 54  . ? 1_555 ? 
2 AC1 4 HIS A 58  ? HIS A 58  . ? 1_555 ? 
3 AC1 4 CYS A 126 ? CYS A 126 . ? 1_555 ? 
4 AC1 4 HOH C .   ? HOH A 395 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1J98 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J98 
_atom_sites.fract_transf_matrix[1][1]   0.015929 
_atom_sites.fract_transf_matrix[1][2]   0.009196 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018393 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006685 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  HIS 11  11  11  HIS HIS A . n 
A 1 12  ASN 12  12  12  ASN ASN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  HIS 21  21  21  HIS HIS A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  ARG 39  39  39  ARG ARG A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  CYS 41  41  41  CYS CYS A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  PRO 43  43  43  PRO PRO A . n 
A 1 44  ASN 44  44  44  ASN ASN A . n 
A 1 45  LYS 45  45  45  LYS LYS A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  THR 55  55  55  THR THR A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  SER 80  80  80  SER SER A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  MET 82  82  82  MET MET A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  OCS 84  84  84  OCS OCS A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  SER 98  98  98  SER SER A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 GLU 100 100 100 GLU GLU A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLU 106 106 106 GLU GLU A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 THR 108 108 108 THR THR A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 CYS 126 126 126 CYS CYS A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 GLN 128 128 128 GLN GLN A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 MET 141 141 141 MET MET A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 TRP 144 144 144 TRP TRP A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ASP 148 148 148 ASP ASP A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   300 300 ZN  ZN  A . 
C 3 HOH 1   301 1   HOH HOH A . 
C 3 HOH 2   302 2   HOH HOH A . 
C 3 HOH 3   303 3   HOH HOH A . 
C 3 HOH 4   304 4   HOH HOH A . 
C 3 HOH 5   305 5   HOH HOH A . 
C 3 HOH 6   306 6   HOH HOH A . 
C 3 HOH 7   307 7   HOH HOH A . 
C 3 HOH 8   308 8   HOH HOH A . 
C 3 HOH 9   309 9   HOH HOH A . 
C 3 HOH 10  310 10  HOH HOH A . 
C 3 HOH 11  311 11  HOH HOH A . 
C 3 HOH 12  312 12  HOH HOH A . 
C 3 HOH 13  313 13  HOH HOH A . 
C 3 HOH 14  314 14  HOH HOH A . 
C 3 HOH 15  315 15  HOH HOH A . 
C 3 HOH 16  316 16  HOH HOH A . 
C 3 HOH 17  317 17  HOH HOH A . 
C 3 HOH 18  318 18  HOH HOH A . 
C 3 HOH 19  319 19  HOH HOH A . 
C 3 HOH 20  320 20  HOH HOH A . 
C 3 HOH 21  321 21  HOH HOH A . 
C 3 HOH 22  322 22  HOH HOH A . 
C 3 HOH 23  323 23  HOH HOH A . 
C 3 HOH 24  324 24  HOH HOH A . 
C 3 HOH 25  325 25  HOH HOH A . 
C 3 HOH 26  326 26  HOH HOH A . 
C 3 HOH 27  327 27  HOH HOH A . 
C 3 HOH 28  328 28  HOH HOH A . 
C 3 HOH 29  329 29  HOH HOH A . 
C 3 HOH 30  330 30  HOH HOH A . 
C 3 HOH 31  331 31  HOH HOH A . 
C 3 HOH 32  332 32  HOH HOH A . 
C 3 HOH 33  333 33  HOH HOH A . 
C 3 HOH 34  334 34  HOH HOH A . 
C 3 HOH 35  335 35  HOH HOH A . 
C 3 HOH 36  336 36  HOH HOH A . 
C 3 HOH 37  337 37  HOH HOH A . 
C 3 HOH 38  338 38  HOH HOH A . 
C 3 HOH 39  339 39  HOH HOH A . 
C 3 HOH 40  340 40  HOH HOH A . 
C 3 HOH 41  341 41  HOH HOH A . 
C 3 HOH 42  342 42  HOH HOH A . 
C 3 HOH 43  343 43  HOH HOH A . 
C 3 HOH 44  344 44  HOH HOH A . 
C 3 HOH 45  345 45  HOH HOH A . 
C 3 HOH 46  346 46  HOH HOH A . 
C 3 HOH 47  347 47  HOH HOH A . 
C 3 HOH 48  348 48  HOH HOH A . 
C 3 HOH 49  349 49  HOH HOH A . 
C 3 HOH 50  350 50  HOH HOH A . 
C 3 HOH 51  351 51  HOH HOH A . 
C 3 HOH 52  352 52  HOH HOH A . 
C 3 HOH 53  353 53  HOH HOH A . 
C 3 HOH 54  354 54  HOH HOH A . 
C 3 HOH 55  355 55  HOH HOH A . 
C 3 HOH 56  356 56  HOH HOH A . 
C 3 HOH 57  357 57  HOH HOH A . 
C 3 HOH 58  358 58  HOH HOH A . 
C 3 HOH 59  359 60  HOH HOH A . 
C 3 HOH 60  360 61  HOH HOH A . 
C 3 HOH 61  361 62  HOH HOH A . 
C 3 HOH 62  362 63  HOH HOH A . 
C 3 HOH 63  363 64  HOH HOH A . 
C 3 HOH 64  364 65  HOH HOH A . 
C 3 HOH 65  365 66  HOH HOH A . 
C 3 HOH 66  366 67  HOH HOH A . 
C 3 HOH 67  367 68  HOH HOH A . 
C 3 HOH 68  368 69  HOH HOH A . 
C 3 HOH 69  369 70  HOH HOH A . 
C 3 HOH 70  370 71  HOH HOH A . 
C 3 HOH 71  371 72  HOH HOH A . 
C 3 HOH 72  372 73  HOH HOH A . 
C 3 HOH 73  373 74  HOH HOH A . 
C 3 HOH 74  374 75  HOH HOH A . 
C 3 HOH 75  375 76  HOH HOH A . 
C 3 HOH 76  376 77  HOH HOH A . 
C 3 HOH 77  377 78  HOH HOH A . 
C 3 HOH 78  378 79  HOH HOH A . 
C 3 HOH 79  379 80  HOH HOH A . 
C 3 HOH 80  380 81  HOH HOH A . 
C 3 HOH 81  381 82  HOH HOH A . 
C 3 HOH 82  382 83  HOH HOH A . 
C 3 HOH 83  383 84  HOH HOH A . 
C 3 HOH 84  384 85  HOH HOH A . 
C 3 HOH 85  385 86  HOH HOH A . 
C 3 HOH 86  386 87  HOH HOH A . 
C 3 HOH 87  387 88  HOH HOH A . 
C 3 HOH 88  388 89  HOH HOH A . 
C 3 HOH 89  389 90  HOH HOH A . 
C 3 HOH 90  390 91  HOH HOH A . 
C 3 HOH 91  391 92  HOH HOH A . 
C 3 HOH 92  392 93  HOH HOH A . 
C 3 HOH 93  393 94  HOH HOH A . 
C 3 HOH 94  394 95  HOH HOH A . 
C 3 HOH 95  395 96  HOH HOH A . 
C 3 HOH 96  396 97  HOH HOH A . 
C 3 HOH 97  397 98  HOH HOH A . 
C 3 HOH 98  398 99  HOH HOH A . 
C 3 HOH 99  399 100 HOH HOH A . 
C 3 HOH 100 400 101 HOH HOH A . 
C 3 HOH 101 401 102 HOH HOH A . 
C 3 HOH 102 402 104 HOH HOH A . 
C 3 HOH 103 403 105 HOH HOH A . 
C 3 HOH 104 404 106 HOH HOH A . 
C 3 HOH 105 405 107 HOH HOH A . 
C 3 HOH 106 406 108 HOH HOH A . 
C 3 HOH 107 407 109 HOH HOH A . 
C 3 HOH 108 408 110 HOH HOH A . 
C 3 HOH 109 409 111 HOH HOH A . 
C 3 HOH 110 410 112 HOH HOH A . 
C 3 HOH 111 411 113 HOH HOH A . 
C 3 HOH 112 412 114 HOH HOH A . 
C 3 HOH 113 413 115 HOH HOH A . 
C 3 HOH 114 414 116 HOH HOH A . 
C 3 HOH 115 415 117 HOH HOH A . 
C 3 HOH 116 416 118 HOH HOH A . 
C 3 HOH 117 417 119 HOH HOH A . 
C 3 HOH 118 418 120 HOH HOH A . 
C 3 HOH 119 419 121 HOH HOH A . 
C 3 HOH 120 420 122 HOH HOH A . 
C 3 HOH 121 421 123 HOH HOH A . 
C 3 HOH 122 422 124 HOH HOH A . 
C 3 HOH 123 423 125 HOH HOH A . 
C 3 HOH 124 424 126 HOH HOH A . 
C 3 HOH 125 425 127 HOH HOH A . 
C 3 HOH 126 426 128 HOH HOH A . 
C 3 HOH 127 427 129 HOH HOH A . 
C 3 HOH 128 428 130 HOH HOH A . 
C 3 HOH 129 429 131 HOH HOH A . 
C 3 HOH 130 430 132 HOH HOH A . 
C 3 HOH 131 431 133 HOH HOH A . 
C 3 HOH 132 432 134 HOH HOH A . 
C 3 HOH 133 433 135 HOH HOH A . 
C 3 HOH 134 434 136 HOH HOH A . 
C 3 HOH 135 435 137 HOH HOH A . 
C 3 HOH 136 436 138 HOH HOH A . 
C 3 HOH 137 437 139 HOH HOH A . 
C 3 HOH 138 438 140 HOH HOH A . 
C 3 HOH 139 439 141 HOH HOH A . 
C 3 HOH 140 440 142 HOH HOH A . 
C 3 HOH 141 441 144 HOH HOH A . 
C 3 HOH 142 442 145 HOH HOH A . 
C 3 HOH 143 443 146 HOH HOH A . 
C 3 HOH 144 444 147 HOH HOH A . 
C 3 HOH 145 445 148 HOH HOH A . 
C 3 HOH 146 446 149 HOH HOH A . 
C 3 HOH 147 447 150 HOH HOH A . 
C 3 HOH 148 448 151 HOH HOH A . 
C 3 HOH 149 449 152 HOH HOH A . 
C 3 HOH 150 450 153 HOH HOH A . 
C 3 HOH 151 451 154 HOH HOH A . 
C 3 HOH 152 452 155 HOH HOH A . 
C 3 HOH 153 453 156 HOH HOH A . 
C 3 HOH 154 454 157 HOH HOH A . 
C 3 HOH 155 455 158 HOH HOH A . 
C 3 HOH 156 456 159 HOH HOH A . 
C 3 HOH 157 457 160 HOH HOH A . 
C 3 HOH 158 458 161 HOH HOH A . 
C 3 HOH 159 459 162 HOH HOH A . 
C 3 HOH 160 460 164 HOH HOH A . 
C 3 HOH 161 461 165 HOH HOH A . 
C 3 HOH 162 462 166 HOH HOH A . 
C 3 HOH 163 463 170 HOH HOH A . 
C 3 HOH 164 464 171 HOH HOH A . 
C 3 HOH 165 465 172 HOH HOH A . 
C 3 HOH 166 466 173 HOH HOH A . 
C 3 HOH 167 467 174 HOH HOH A . 
C 3 HOH 168 468 175 HOH HOH A . 
C 3 HOH 169 469 176 HOH HOH A . 
C 3 HOH 170 470 177 HOH HOH A . 
C 3 HOH 171 471 178 HOH HOH A . 
C 3 HOH 172 472 179 HOH HOH A . 
C 3 HOH 173 473 180 HOH HOH A . 
C 3 HOH 174 474 181 HOH HOH A . 
C 3 HOH 175 475 182 HOH HOH A . 
C 3 HOH 176 476 183 HOH HOH A . 
C 3 HOH 177 477 184 HOH HOH A . 
C 3 HOH 178 478 185 HOH HOH A . 
C 3 HOH 179 479 186 HOH HOH A . 
C 3 HOH 180 480 187 HOH HOH A . 
C 3 HOH 181 481 188 HOH HOH A . 
C 3 HOH 182 482 189 HOH HOH A . 
C 3 HOH 183 483 190 HOH HOH A . 
C 3 HOH 184 484 192 HOH HOH A . 
C 3 HOH 185 485 193 HOH HOH A . 
C 3 HOH 186 486 194 HOH HOH A . 
C 3 HOH 187 487 195 HOH HOH A . 
C 3 HOH 188 488 196 HOH HOH A . 
C 3 HOH 189 489 197 HOH HOH A . 
C 3 HOH 190 490 199 HOH HOH A . 
C 3 HOH 191 491 200 HOH HOH A . 
C 3 HOH 192 492 201 HOH HOH A . 
C 3 HOH 193 493 202 HOH HOH A . 
C 3 HOH 194 494 203 HOH HOH A . 
C 3 HOH 195 495 204 HOH HOH A . 
C 3 HOH 196 496 205 HOH HOH A . 
C 3 HOH 197 497 206 HOH HOH A . 
C 3 HOH 198 498 207 HOH HOH A . 
C 3 HOH 199 499 208 HOH HOH A . 
C 3 HOH 200 500 209 HOH HOH A . 
C 3 HOH 201 501 210 HOH HOH A . 
C 3 HOH 202 502 211 HOH HOH A . 
C 3 HOH 203 503 212 HOH HOH A . 
C 3 HOH 204 504 213 HOH HOH A . 
C 3 HOH 205 505 214 HOH HOH A . 
C 3 HOH 206 506 216 HOH HOH A . 
C 3 HOH 207 507 217 HOH HOH A . 
C 3 HOH 208 508 218 HOH HOH A . 
C 3 HOH 209 509 219 HOH HOH A . 
C 3 HOH 210 510 220 HOH HOH A . 
C 3 HOH 211 511 221 HOH HOH A . 
C 3 HOH 212 512 223 HOH HOH A . 
C 3 HOH 213 513 224 HOH HOH A . 
C 3 HOH 214 514 225 HOH HOH A . 
C 3 HOH 215 515 226 HOH HOH A . 
C 3 HOH 216 516 227 HOH HOH A . 
C 3 HOH 217 517 228 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    OCS 
_pdbx_struct_mod_residue.label_seq_id     84 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     OCS 
_pdbx_struct_mod_residue.auth_seq_id      84 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   CYS 
_pdbx_struct_mod_residue.details          'CYSTEINESULFONIC ACID' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4000  ? 
1 MORE         -93   ? 
1 'SSA (A^2)'  12750 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000 0.0000000000 0.0000000000 0.0000000000   0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/6 0.5000000000 0.8660254038 0.0000000000 -31.3900000000 0.8660254038 
-0.5000000000 0.0000000000 54.3690748496 0.0000000000 0.0000000000 -1.0000000000 -24.9300000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 54  ? A HIS 54  ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 58  ? A HIS 58  ? 1_555 103.1 ? 
2 NE2 ? A HIS 54  ? A HIS 54  ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG  ? A CYS 126 ? A CYS 126 ? 1_555 102.2 ? 
3 NE2 ? A HIS 58  ? A HIS 58  ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG  ? A CYS 126 ? A CYS 126 ? 1_555 113.4 ? 
4 NE2 ? A HIS 54  ? A HIS 54  ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O   ? C HOH .   ? A HOH 395 ? 1_555 116.2 ? 
5 NE2 ? A HIS 58  ? A HIS 58  ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O   ? C HOH .   ? A HOH 395 ? 1_555 112.0 ? 
6 SG  ? A CYS 126 ? A CYS 126 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 O   ? C HOH .   ? A HOH 395 ? 1_555 109.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-06-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.value'               
16 4 'Structure model' '_struct_conn.pdbx_dist_value'                
17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
18 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
19 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
20 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
30 4 'Structure model' '_struct_ref_seq_dif.details'                 
31 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
32 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
33 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MLPHARE   phasing          . ? 1 
REFMAC    refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 405 ? ? O   A HOH 483 ? ? 1.64 
2 1 NH1 A ARG 142 ? ? O   A HOH 458 ? ? 1.99 
3 1 O   A HOH 301 ? ? O   A HOH 463 ? ? 2.03 
4 1 O   A HOH 417 ? ? O   A HOH 463 ? ? 2.07 
5 1 O   A LEU 59  ? ? OG1 A THR 63  ? A 2.16 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 401 ? ? 1_555 O A HOH 464 ? ? 8_565  2.00 
2 1 OE1 A GLU 95  ? ? 1_555 O A HOH 471 ? ? 8_665  2.14 
3 1 OD2 A OCS 84  ? ? 1_555 O A HOH 440 ? ? 12_564 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 30  ? ? -142.06 10.91 
2 1 GLN A 128 ? ? -154.48 73.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A PRO 2 ? A PRO 2 
3 1 Y 1 A SER 3 ? A SER 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#