data_1JHB
# 
_entry.id   1JHB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1JHB         pdb_00001jhb 10.2210/pdb1jhb/pdb 
WWPDB D_1000174328 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-08-26 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-02-23 
5 'Structure model' 1 4 2024-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
5 4 'Structure model' Other                       
6 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2            
2 4 'Structure model' pdbx_database_status  
3 4 'Structure model' pdbx_struct_assembly  
4 4 'Structure model' pdbx_struct_oper_list 
5 5 'Structure model' chem_comp_atom        
6 5 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_database_status.process_site'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1JHB 
_pdbx_database_status.recvd_initial_deposition_date   1998-02-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sun, C.'          1 
'Bushweller, J.H.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The NMR solution structure of human glutaredoxin in the fully reduced form.' J.Mol.Biol.    280 687 701 1998 JMOBAK UK 
0022-2836 0070 ? 9677297 10.1006/jmbi.1998.1913 
1       
'Complete 1H, 13C, and 15N NMR Resonance Assignments and Secondary Structure of Human Glutaredoxin in the Fully Reduced Form' 
'Protein Sci.' 6   383 ?   1997 PRCIEI US 0961-8368 0795 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sun, C.'          1 ? 
primary 'Berardi, M.J.'    2 ? 
primary 'Bushweller, J.H.' 3 ? 
1       'Sun, C.'          4 ? 
1       'Holmgren, A.'     5 ? 
1       'Bushweller, J.H.' 6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           GLUTAREDOXIN 
_entity.formula_weight             11787.710 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCI
GGCSDLVSLQQSGELLTRLKQIGALQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCI
GGCSDLVSLQQSGELLTRLKQIGALQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLN n 
1 4   GLU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASN n 
1 8   CYS n 
1 9   LYS n 
1 10  ILE n 
1 11  GLN n 
1 12  PRO n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  VAL n 
1 17  VAL n 
1 18  PHE n 
1 19  ILE n 
1 20  LYS n 
1 21  PRO n 
1 22  THR n 
1 23  CYS n 
1 24  PRO n 
1 25  TYR n 
1 26  CYS n 
1 27  ARG n 
1 28  ARG n 
1 29  ALA n 
1 30  GLN n 
1 31  GLU n 
1 32  ILE n 
1 33  LEU n 
1 34  SER n 
1 35  GLN n 
1 36  LEU n 
1 37  PRO n 
1 38  ILE n 
1 39  LYS n 
1 40  GLN n 
1 41  GLY n 
1 42  LEU n 
1 43  LEU n 
1 44  GLU n 
1 45  PHE n 
1 46  VAL n 
1 47  ASP n 
1 48  ILE n 
1 49  THR n 
1 50  ALA n 
1 51  THR n 
1 52  ASN n 
1 53  HIS n 
1 54  THR n 
1 55  ASN n 
1 56  GLU n 
1 57  ILE n 
1 58  GLN n 
1 59  ASP n 
1 60  TYR n 
1 61  LEU n 
1 62  GLN n 
1 63  GLN n 
1 64  LEU n 
1 65  THR n 
1 66  GLY n 
1 67  ALA n 
1 68  ARG n 
1 69  THR n 
1 70  VAL n 
1 71  PRO n 
1 72  ARG n 
1 73  VAL n 
1 74  PHE n 
1 75  ILE n 
1 76  GLY n 
1 77  LYS n 
1 78  ASP n 
1 79  CYS n 
1 80  ILE n 
1 81  GLY n 
1 82  GLY n 
1 83  CYS n 
1 84  SER n 
1 85  ASP n 
1 86  LEU n 
1 87  VAL n 
1 88  SER n 
1 89  LEU n 
1 90  GLN n 
1 91  GLN n 
1 92  SER n 
1 93  GLY n 
1 94  GLU n 
1 95  LEU n 
1 96  LEU n 
1 97  THR n 
1 98  ARG n 
1 99  LEU n 
1 100 LYS n 
1 101 GLN n 
1 102 ILE n 
1 103 GLY n 
1 104 ALA n 
1 105 LEU n 
1 106 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PET 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  CYS 23  23  23  CYS CYS A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  ILE 32  32  32  ILE ILE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLN 35  35  35  GLN GLN A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  ILE 38  38  38  ILE ILE A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  GLN 40  40  40  GLN GLN A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  LEU 61  61  61  LEU LEU A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  PHE 74  74  74  PHE PHE A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 GLY 103 103 103 GLY GLY A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DYANA 'model building' . ? 1 
DYANA refinement       . ? 2 
# 
_cell.entry_id           1JHB 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1JHB 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1JHB 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1JHB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1JHB 
_struct.title                     'HUMAN GLUTAREDOXIN IN FULLY REDUCED FORM, NMR, 20 STRUCTURES' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1JHB 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'GLUTAREDOXIN, OXIDOREDUCTASE, ELECTRON TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GLRX1_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P35754 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;AQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIG
GCSDLVSLQQSGELLTRLKQIGALQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1JHB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 106 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35754 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  105 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       106 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 GLU A 4  ? LYS A 9   ? GLU A 4  LYS A 9   1 ? 6  
HELX_P HELX_P2 H2 PRO A 24 ? SER A 34  ? PRO A 24 SER A 34  1 ? 11 
HELX_P HELX_P3 H3 THR A 54 ? THR A 65  ? THR A 54 THR A 65  1 ? 12 
HELX_P HELX_P4 H4 SER A 84 ? GLN A 91  ? SER A 84 GLN A 91  1 ? 8  
HELX_P HELX_P5 H5 GLU A 94 ? LYS A 100 ? GLU A 94 LYS A 100 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            hydrog1 
_struct_conn.conn_type_id                  hydrog 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            23 
_struct_conn.ptnr1_label_atom_id           O 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           ARG 
_struct_conn.ptnr2_label_seq_id            27 
_struct_conn.ptnr2_label_atom_id           N 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             23 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            ARG 
_struct_conn.ptnr2_auth_seq_id             27 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               ? 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 1  -3.52  
2  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 2  -5.29  
3  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 3  -10.00 
4  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 4  -6.96  
5  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 5  -1.21  
6  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 6  -10.95 
7  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 7  3.46   
8  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 8  -11.91 
9  VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 9  -4.64  
10 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 10 -9.01  
11 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 11 -4.19  
12 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 12 -7.29  
13 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 13 -13.90 
14 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 14 -8.35  
15 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 15 -4.55  
16 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 16 -7.89  
17 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 17 -15.44 
18 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 18 -5.15  
19 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 19 -15.57 
20 VAL 70 A . ? VAL 70 A PRO 71 A ? PRO 71 A 20 -4.99  
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? parallel      
S1 2 3 ? anti-parallel 
S1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 LEU A 43 ? ASP A 47 ? LEU A 43 ASP A 47 
S1 2 VAL A 15 ? ILE A 19 ? VAL A 15 ILE A 19 
S1 3 ARG A 72 ? ILE A 75 ? ARG A 72 ILE A 75 
S1 4 ASP A 78 ? GLY A 81 ? ASP A 78 GLY A 81 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 O GLU A 44 ? O GLU A 44 N VAL A 17 ? N VAL A 17 
S1 2 3 O VAL A 16 ? O VAL A 16 N PHE A 74 ? N PHE A 74 
S1 3 4 O VAL A 73 ? O VAL A 73 N ILE A 80 ? N ILE A 80 
# 
_struct_site.id                   AVE 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    2 
_struct_site.details              'ACTIVE SITE.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AVE 2 CYS A 23 ? CYS A 23 . ? 1_555 ? 
2 AVE 2 CYS A 26 ? CYS A 26 . ? 1_555 ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 7  OD1 A ASP 47 ? ? HG1 A THR 49 ? ? 1.56 
2 12 OD1 A ASP 47 ? ? HG1 A THR 49 ? ? 1.58 
3 19 HG  A SER 92 ? ? OE1 A GLU 94 ? ? 1.56 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 9 CD A ARG 98 ? ? NE A ARG 98 ? ? CZ  A ARG 98 ? ? 132.24 123.60 8.64  1.40 N 
2 9 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH1 A ARG 98 ? ? 123.66 120.30 3.36  0.50 N 
3 9 NE A ARG 98 ? ? CZ A ARG 98 ? ? NH2 A ARG 98 ? ? 116.50 120.30 -3.80 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  VAL A 15  ? ? -103.68 79.17   
2   1  THR A 51  ? ? -149.29 20.74   
3   1  ASN A 52  ? ? -156.60 -148.64 
4   1  LYS A 77  ? ? 46.43   16.69   
5   1  ALA A 104 ? ? -84.31  -74.52  
6   2  GLN A 3   ? ? -66.67  34.54   
7   2  GLU A 4   ? ? -163.42 -57.41  
8   2  THR A 22  ? ? -133.35 -106.17 
9   2  CYS A 23  ? ? 33.83   115.06  
10  2  THR A 51  ? ? -150.97 -43.67  
11  2  ASN A 52  ? ? -170.53 -160.30 
12  2  THR A 65  ? ? -116.09 -71.67  
13  2  LYS A 77  ? ? 46.67   22.10   
14  2  CYS A 83  ? ? -132.43 -55.70  
15  2  ALA A 104 ? ? -75.74  -70.47  
16  3  GLN A 3   ? ? 34.22   -91.42  
17  3  THR A 22  ? ? -75.58  31.45   
18  3  ASN A 52  ? ? -78.63  -106.66 
19  3  HIS A 53  ? ? -163.60 93.12   
20  3  LYS A 77  ? ? 47.26   21.14   
21  4  GLN A 3   ? ? 34.74   58.70   
22  4  GLU A 4   ? ? 61.79   -34.12  
23  4  THR A 65  ? ? -127.22 -72.22  
24  4  LYS A 77  ? ? 46.21   27.73   
25  4  ALA A 104 ? ? -91.34  -72.49  
26  5  GLN A 3   ? ? -66.95  46.78   
27  5  GLU A 4   ? ? -163.53 -56.41  
28  5  PRO A 12  ? ? -67.50  79.18   
29  5  VAL A 15  ? ? -113.07 79.39   
30  5  ALA A 50  ? ? -69.04  53.14   
31  5  HIS A 53  ? ? 67.62   79.82   
32  5  LYS A 77  ? ? 46.48   15.28   
33  6  GLN A 3   ? ? -48.64  158.06  
34  6  CYS A 8   ? ? -81.40  38.60   
35  6  LYS A 9   ? ? -130.91 -47.79  
36  6  VAL A 15  ? ? -119.88 79.58   
37  6  THR A 51  ? ? -172.03 -27.19  
38  6  HIS A 53  ? ? 124.63  82.32   
39  6  LYS A 77  ? ? 47.31   21.37   
40  6  ALA A 104 ? ? -84.93  -74.86  
41  7  VAL A 6   ? ? -90.51  -60.26  
42  7  THR A 51  ? ? -132.78 -106.41 
43  7  LYS A 77  ? ? 46.13   19.53   
44  7  ALA A 104 ? ? -114.46 -75.65  
45  8  GLN A 3   ? ? -85.45  48.30   
46  8  GLU A 4   ? ? -163.45 -43.13  
47  8  THR A 65  ? ? -125.06 -76.03  
48  9  GLU A 4   ? ? -163.10 -55.88  
49  9  ASN A 52  ? ? 57.76   -163.37 
50  9  LYS A 77  ? ? 46.55   -9.18   
51  9  CYS A 83  ? ? -128.45 -62.15  
52  10 GLN A 3   ? ? -53.67  32.98   
53  10 GLU A 4   ? ? -163.44 -58.04  
54  10 PRO A 12  ? ? -73.83  26.08   
55  10 THR A 51  ? ? -148.80 -39.94  
56  10 HIS A 53  ? ? 71.33   80.92   
57  10 LYS A 77  ? ? 46.58   9.41    
58  11 GLN A 3   ? ? 38.59   -62.86  
59  11 GLU A 4   ? ? -163.31 -50.69  
60  11 THR A 51  ? ? -160.08 -15.57  
61  11 HIS A 53  ? ? 127.73  105.49  
62  11 LYS A 77  ? ? 46.22   -2.51   
63  11 ALA A 104 ? ? -111.86 -74.17  
64  12 GLN A 3   ? ? 56.42   -13.75  
65  12 GLU A 4   ? ? -163.94 -38.90  
66  12 THR A 22  ? ? -118.67 -99.99  
67  12 CYS A 23  ? ? 32.48   100.94  
68  12 ASN A 52  ? ? 54.57   -6.46   
69  12 HIS A 53  ? ? -68.02  17.14   
70  12 THR A 65  ? ? -97.49  -75.89  
71  12 LYS A 77  ? ? 46.61   24.29   
72  12 CYS A 83  ? ? -121.71 -64.60  
73  13 GLN A 3   ? ? -67.40  -99.40  
74  13 VAL A 6   ? ? -109.79 -69.91  
75  13 THR A 51  ? ? -157.61 -40.13  
76  13 HIS A 53  ? ? 144.24  103.57  
77  13 LYS A 77  ? ? 46.06   20.39   
78  14 GLN A 3   ? ? 75.22   -173.31 
79  14 GLU A 4   ? ? -48.76  -10.04  
80  14 PRO A 21  ? ? -75.06  28.77   
81  14 THR A 22  ? ? -147.23 29.48   
82  14 PRO A 37  ? ? -78.38  42.23   
83  14 ASN A 52  ? ? -143.48 -93.64  
84  14 HIS A 53  ? ? -160.22 57.28   
85  14 LYS A 77  ? ? 46.65   14.32   
86  14 ALA A 104 ? ? -101.21 -78.21  
87  15 GLN A 3   ? ? 57.40   165.27  
88  15 THR A 22  ? ? -81.89  48.48   
89  15 THR A 51  ? ? -149.47 -70.12  
90  15 ASN A 52  ? ? -34.10  -86.34  
91  15 HIS A 53  ? ? -164.18 99.91   
92  15 THR A 65  ? ? -120.79 -62.56  
93  15 LYS A 77  ? ? 46.52   3.11    
94  15 ALA A 104 ? ? -134.85 -76.41  
95  16 GLU A 4   ? ? -163.04 -58.63  
96  16 ASN A 52  ? ? -146.62 -0.54   
97  16 HIS A 53  ? ? 69.90   88.86   
98  16 THR A 65  ? ? -101.10 -65.19  
99  16 LYS A 77  ? ? 46.72   13.09   
100 16 ALA A 104 ? ? -116.28 -73.04  
101 17 GLN A 3   ? ? -136.98 -56.60  
102 17 ALA A 50  ? ? -63.62  68.79   
103 17 THR A 51  ? ? 55.99   -4.54   
104 17 HIS A 53  ? ? 78.25   87.58   
105 17 LYS A 77  ? ? 46.14   17.30   
106 17 ALA A 104 ? ? -138.41 -70.11  
107 18 GLU A 4   ? ? -163.07 -60.76  
108 18 GLN A 40  ? ? -39.96  100.59  
109 18 THR A 51  ? ? 68.36   -16.07  
110 18 THR A 65  ? ? -121.34 -65.92  
111 18 ALA A 104 ? ? -89.14  -74.52  
112 19 GLN A 3   ? ? -75.92  28.56   
113 19 GLU A 4   ? ? -163.03 -56.93  
114 19 THR A 51  ? ? -137.14 -55.11  
115 19 ASN A 52  ? ? -165.76 -161.33 
116 19 HIS A 53  ? ? 62.33   -3.39   
117 19 SER A 84  ? ? 61.46   -76.17  
118 19 ALA A 104 ? ? -83.96  -70.46  
119 20 GLU A 4   ? ? -163.78 -54.30  
120 20 THR A 22  ? ? -138.20 -106.63 
121 20 CYS A 23  ? ? 32.65   104.21  
122 20 THR A 51  ? ? -122.70 -77.83  
123 20 ASN A 52  ? ? -162.77 -163.12 
124 20 THR A 65  ? ? -125.84 -76.23  
125 20 LYS A 77  ? ? 46.83   -12.51  
126 20 CYS A 83  ? ? -126.23 -64.15  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 72 ? ? 0.087 'SIDE CHAIN' 
2  2  ARG A 27 ? ? 0.115 'SIDE CHAIN' 
3  2  ARG A 28 ? ? 0.094 'SIDE CHAIN' 
4  2  ARG A 72 ? ? 0.075 'SIDE CHAIN' 
5  3  TYR A 60 ? ? 0.084 'SIDE CHAIN' 
6  3  ARG A 98 ? ? 0.080 'SIDE CHAIN' 
7  4  ARG A 72 ? ? 0.123 'SIDE CHAIN' 
8  6  TYR A 60 ? ? 0.114 'SIDE CHAIN' 
9  6  ARG A 98 ? ? 0.088 'SIDE CHAIN' 
10 8  TYR A 25 ? ? 0.070 'SIDE CHAIN' 
11 8  ARG A 28 ? ? 0.108 'SIDE CHAIN' 
12 8  ARG A 68 ? ? 0.078 'SIDE CHAIN' 
13 9  ARG A 27 ? ? 0.124 'SIDE CHAIN' 
14 9  ARG A 68 ? ? 0.096 'SIDE CHAIN' 
15 10 ARG A 27 ? ? 0.110 'SIDE CHAIN' 
16 11 ARG A 68 ? ? 0.105 'SIDE CHAIN' 
17 11 ARG A 98 ? ? 0.099 'SIDE CHAIN' 
18 12 ARG A 98 ? ? 0.089 'SIDE CHAIN' 
19 13 TYR A 25 ? ? 0.116 'SIDE CHAIN' 
20 13 TYR A 60 ? ? 0.080 'SIDE CHAIN' 
21 15 ARG A 72 ? ? 0.083 'SIDE CHAIN' 
22 16 TYR A 25 ? ? 0.077 'SIDE CHAIN' 
23 17 ARG A 28 ? ? 0.085 'SIDE CHAIN' 
24 17 ARG A 68 ? ? 0.093 'SIDE CHAIN' 
25 19 ARG A 68 ? ? 0.099 'SIDE CHAIN' 
26 20 ARG A 28 ? ? 0.086 'SIDE CHAIN' 
27 20 ARG A 98 ? ? 0.104 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.entry_id                             1JHB 
_pdbx_nmr_ensemble.conformers_calculated_total_number   50 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         'LEAST RESTRAINT VIOLATION' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 NOESY            1 
2  1 HCCH-TOCSY       1 
3  1 HACAHB           1 
4  1 HNHB             1 
5  1 HSQC             1 
6  1 CT-HSQC          1 
7  1 HNCA             1 
8  1 'HN(CO)CA'       1 
9  1 HNCACB           1 
10 1 'HN (CO)CACB'    1 
11 1 'HN(CA)HA'       1 
12 1 HNCO             1 
13 1 '(HB)CB(CGCD)HD' 1 
14 1 'HB(CBCGCD)HD'   1 
# 
_pdbx_nmr_refine.entry_id           1JHB 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           OPAL  ? LUGINBUHL,GUNTERT,BILLETER,WUTHRICH 1 
'structure solution' DYANA ? ?                                   2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1  Y 1 A MET 1 ? A MET 1 
2  2  Y 1 A MET 1 ? A MET 1 
3  3  Y 1 A MET 1 ? A MET 1 
4  4  Y 1 A MET 1 ? A MET 1 
5  5  Y 1 A MET 1 ? A MET 1 
6  6  Y 1 A MET 1 ? A MET 1 
7  7  Y 1 A MET 1 ? A MET 1 
8  8  Y 1 A MET 1 ? A MET 1 
9  9  Y 1 A MET 1 ? A MET 1 
10 10 Y 1 A MET 1 ? A MET 1 
11 11 Y 1 A MET 1 ? A MET 1 
12 12 Y 1 A MET 1 ? A MET 1 
13 13 Y 1 A MET 1 ? A MET 1 
14 14 Y 1 A MET 1 ? A MET 1 
15 15 Y 1 A MET 1 ? A MET 1 
16 16 Y 1 A MET 1 ? A MET 1 
17 17 Y 1 A MET 1 ? A MET 1 
18 18 Y 1 A MET 1 ? A MET 1 
19 19 Y 1 A MET 1 ? A MET 1 
20 20 Y 1 A MET 1 ? A MET 1 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TYR N    N N N 318 
TYR CA   C N S 319 
TYR C    C N N 320 
TYR O    O N N 321 
TYR CB   C N N 322 
TYR CG   C Y N 323 
TYR CD1  C Y N 324 
TYR CD2  C Y N 325 
TYR CE1  C Y N 326 
TYR CE2  C Y N 327 
TYR CZ   C Y N 328 
TYR OH   O N N 329 
TYR OXT  O N N 330 
TYR H    H N N 331 
TYR H2   H N N 332 
TYR HA   H N N 333 
TYR HB2  H N N 334 
TYR HB3  H N N 335 
TYR HD1  H N N 336 
TYR HD2  H N N 337 
TYR HE1  H N N 338 
TYR HE2  H N N 339 
TYR HH   H N N 340 
TYR HXT  H N N 341 
VAL N    N N N 342 
VAL CA   C N S 343 
VAL C    C N N 344 
VAL O    O N N 345 
VAL CB   C N N 346 
VAL CG1  C N N 347 
VAL CG2  C N N 348 
VAL OXT  O N N 349 
VAL H    H N N 350 
VAL H2   H N N 351 
VAL HA   H N N 352 
VAL HB   H N N 353 
VAL HG11 H N N 354 
VAL HG12 H N N 355 
VAL HG13 H N N 356 
VAL HG21 H N N 357 
VAL HG22 H N N 358 
VAL HG23 H N N 359 
VAL HXT  H N N 360 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TYR N   CA   sing N N 304 
TYR N   H    sing N N 305 
TYR N   H2   sing N N 306 
TYR CA  C    sing N N 307 
TYR CA  CB   sing N N 308 
TYR CA  HA   sing N N 309 
TYR C   O    doub N N 310 
TYR C   OXT  sing N N 311 
TYR CB  CG   sing N N 312 
TYR CB  HB2  sing N N 313 
TYR CB  HB3  sing N N 314 
TYR CG  CD1  doub Y N 315 
TYR CG  CD2  sing Y N 316 
TYR CD1 CE1  sing Y N 317 
TYR CD1 HD1  sing N N 318 
TYR CD2 CE2  doub Y N 319 
TYR CD2 HD2  sing N N 320 
TYR CE1 CZ   doub Y N 321 
TYR CE1 HE1  sing N N 322 
TYR CE2 CZ   sing Y N 323 
TYR CE2 HE2  sing N N 324 
TYR CZ  OH   sing N N 325 
TYR OH  HH   sing N N 326 
TYR OXT HXT  sing N N 327 
VAL N   CA   sing N N 328 
VAL N   H    sing N N 329 
VAL N   H2   sing N N 330 
VAL CA  C    sing N N 331 
VAL CA  CB   sing N N 332 
VAL CA  HA   sing N N 333 
VAL C   O    doub N N 334 
VAL C   OXT  sing N N 335 
VAL CB  CG1  sing N N 336 
VAL CB  CG2  sing N N 337 
VAL CB  HB   sing N N 338 
VAL CG1 HG11 sing N N 339 
VAL CG1 HG12 sing N N 340 
VAL CG1 HG13 sing N N 341 
VAL CG2 HG21 sing N N 342 
VAL CG2 HG22 sing N N 343 
VAL CG2 HG23 sing N N 344 
VAL OXT HXT  sing N N 345 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'UNITYPLUS 500' 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_atom_sites.entry_id                    1JHB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_