data_1JN7 # _entry.id 1JN7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JN7 pdb_00001jn7 10.2210/pdb1jn7/pdb RCSB RCSB013962 ? ? WWPDB D_1000013962 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1FU9 '1FU9 is the Solution Structure Of The Ninth Zinc-Finger Domain Of The U-Shaped Transcription Factor' unspecified PDB 1FV5 '1FV5 is the Solution Structure Of The First Zinc Finger From The Drosophila U-Shaped Transcription Factor' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JN7 _pdbx_database_status.recvd_initial_deposition_date 2001-07-23 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kowalski, K.' 1 'Mackay, J.P.' 2 # _citation.id primary _citation.title 'Characterization of the Conserved Interaction between GATA and FOG Family Proteins' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 35720 _citation.page_last 35729 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12110675 _citation.pdbx_database_id_DOI 10.1074/jbc.M204663200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kowalski, K.' 1 ? primary 'Liew, C.K.' 2 ? primary 'Matthews, J.M.' 3 ? primary 'Gell, D.A.' 4 ? primary 'Crossley, M.' 5 ? primary 'Mackay, J.P.' 6 ? # _cell.entry_id 1JN7 _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'U-shaped TRANSCRIPTIONAL COFACTOR' 4209.866 1 ? C32H 'NINTH ZINC-FINGER DOMAIN' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYHKNKP _entity_poly.pdbx_seq_one_letter_code_can GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYHKNKP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 ALA n 1 5 GLU n 1 6 VAL n 1 7 MET n 1 8 LYS n 1 9 LYS n 1 10 TYR n 1 11 CYS n 1 12 SER n 1 13 THR n 1 14 CYS n 1 15 ASP n 1 16 ILE n 1 17 SER n 1 18 PHE n 1 19 ASN n 1 20 TYR n 1 21 VAL n 1 22 LYS n 1 23 THR n 1 24 TYR n 1 25 LEU n 1 26 ALA n 1 27 HIS n 1 28 LYS n 1 29 GLN n 1 30 PHE n 1 31 TYR n 1 32 HIS n 1 33 LYS n 1 34 ASN n 1 35 LYS n 1 36 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene U-shaped _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-2T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code USH_DROME _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP _struct_ref.pdbx_align_begin 587 _struct_ref.pdbx_db_accession Q9VPQ6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1JN7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 36 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9VPQ6 _struct_ref_seq.db_align_beg 587 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 620 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1JN7 GLY A 1 ? UNP Q9VPQ6 ? ? 'cloning artifact' 1 1 1 1JN7 SER A 2 ? UNP Q9VPQ6 ? ? 'cloning artifact' 2 2 1 1JN7 HIS A 32 ? UNP Q9VPQ6 CYS 616 'engineered mutation' 32 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 E-COSY 4 2 2 HNHA # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ambient 5.0 '1.5mM ZnSO4' ? K 2 293 ambient 5.0 '0.75mM ZnSO4' ? K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM protein; 1.5mM ZnSO4; 1.5mM TCEP; 95% H2O, 5% D2O' '95% H2O/5% D2O' 2 '0.5mM protein U-15N; 0.75mM ZnSO4; 0.75mM TCEP; 95% H2O, 5% D2O' '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1JN7 _pdbx_nmr_refine.method ;torsion angle dynamics simulated annealing ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1JN7 _pdbx_nmr_details.text 'The structure was determined using standard 2D homonuclear techniques' # _pdbx_nmr_ensemble.entry_id 1JN7 _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JN7 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 processing Bruker 1 DYANA 1.5 'structure solution' 'Guntert et al' 2 CNS 0.5 refinement 'Brunger et al' 3 # _exptl.entry_id 1JN7 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JN7 _struct.title 'Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JN7 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'zinc finger, protein-protein interaction, transcription' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 31 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 20 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 31 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 11 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 11 A ZN 37 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A CYS 14 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 14 A ZN 37 1_555 ? ? ? ? ? ? ? 2.294 ? ? metalc3 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 27 A ZN 37 1_555 ? ? ? ? ? ? ? 1.994 ? ? metalc4 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 32 A ZN 37 1_555 ? ? ? ? ? ? ? 1.989 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 10 ? CYS A 11 ? TYR A 10 CYS A 11 A 2 ILE A 16 ? SER A 17 ? ILE A 16 SER A 17 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id CYS _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id CYS _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 11 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 16 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 37 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 37' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 11 ? CYS A 11 . ? 1_555 ? 2 AC1 4 CYS A 14 ? CYS A 14 . ? 1_555 ? 3 AC1 4 HIS A 27 ? HIS A 27 . ? 1_555 ? 4 AC1 4 HIS A 32 ? HIS A 32 . ? 1_555 ? # _database_PDB_matrix.entry_id 1JN7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JN7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 MET 7 7 7 MET MET A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 37 _pdbx_nonpoly_scheme.auth_seq_num 37 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 SG ? A CYS 14 ? A CYS 14 ? 1_555 113.3 ? 2 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 112.8 ? 3 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 112.3 ? 4 SG ? A CYS 11 ? A CYS 11 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 109.7 ? 5 SG ? A CYS 14 ? A CYS 14 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 109.9 ? 6 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 ZN ? B ZN . ? A ZN 37 ? 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 97.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-09-25 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -170.42 -169.40 2 1 ALA A 4 ? ? -175.08 -70.41 3 1 GLU A 5 ? ? 165.51 64.85 4 1 MET A 7 ? ? 64.26 171.99 5 1 LYS A 8 ? ? -147.25 -76.64 6 1 HIS A 32 ? ? -97.34 39.17 7 1 LYS A 33 ? ? -177.74 74.10 8 1 LYS A 35 ? ? -176.77 56.49 9 2 ALA A 4 ? ? 58.96 100.11 10 2 GLU A 5 ? ? 165.51 64.85 11 2 MET A 7 ? ? -173.83 79.98 12 2 LYS A 8 ? ? -151.52 -85.23 13 2 LYS A 9 ? ? -147.00 45.88 14 2 THR A 13 ? ? -134.38 -34.87 15 2 HIS A 32 ? ? -96.12 42.73 16 2 LYS A 33 ? ? -172.51 44.34 17 2 ASN A 34 ? ? -174.24 36.60 18 2 LYS A 35 ? ? 59.92 84.46 19 3 SER A 2 ? ? -166.65 33.70 20 3 GLU A 5 ? ? 165.45 64.96 21 3 MET A 7 ? ? 60.35 89.36 22 3 THR A 13 ? ? -134.42 -35.14 23 3 HIS A 32 ? ? -95.77 42.43 24 3 LYS A 33 ? ? -168.89 44.31 25 3 ASN A 34 ? ? -175.00 36.94 26 3 LYS A 35 ? ? -174.97 87.62 27 4 SER A 2 ? ? 60.37 85.79 28 4 ALA A 3 ? ? -109.69 40.01 29 4 GLU A 5 ? ? 165.48 64.80 30 4 VAL A 6 ? ? -92.52 57.08 31 4 MET A 7 ? ? -162.40 82.13 32 4 LYS A 8 ? ? -178.48 87.22 33 4 THR A 13 ? ? -134.35 -34.96 34 4 HIS A 32 ? ? -113.16 51.28 35 4 LYS A 33 ? ? -144.96 54.76 36 5 ALA A 3 ? ? 59.97 95.35 37 5 GLU A 5 ? ? 165.49 64.96 38 5 MET A 7 ? ? 61.62 83.96 39 5 LYS A 8 ? ? -179.15 -38.17 40 5 THR A 13 ? ? -134.38 -35.07 41 5 HIS A 32 ? ? -98.06 43.84 42 5 LYS A 33 ? ? -145.25 44.60 43 5 ASN A 34 ? ? -160.52 39.56 44 5 LYS A 35 ? ? 61.31 153.31 45 6 SER A 2 ? ? 58.60 171.84 46 6 ALA A 4 ? ? 60.61 70.72 47 6 GLU A 5 ? ? 165.40 64.90 48 6 MET A 7 ? ? -162.08 62.44 49 6 THR A 13 ? ? -134.47 -34.99 50 6 HIS A 32 ? ? -97.02 39.68 51 6 LYS A 33 ? ? -174.84 44.24 52 6 LYS A 35 ? ? -160.98 86.09 53 7 SER A 2 ? ? 60.69 156.99 54 7 ALA A 4 ? ? -168.77 61.34 55 7 GLU A 5 ? ? 165.51 64.93 56 7 MET A 7 ? ? 66.96 65.88 57 7 THR A 13 ? ? -134.51 -35.10 58 7 HIS A 32 ? ? -95.81 42.67 59 7 LYS A 33 ? ? -174.20 44.33 60 7 ASN A 34 ? ? -102.61 42.61 61 8 ALA A 3 ? ? -175.05 112.90 62 8 ALA A 4 ? ? -153.38 -46.43 63 8 GLU A 5 ? ? 165.51 64.94 64 8 MET A 7 ? ? 62.43 111.49 65 8 LYS A 8 ? ? -165.23 -83.57 66 8 LYS A 9 ? ? -149.72 45.73 67 8 LYS A 35 ? ? -176.59 90.62 68 9 SER A 2 ? ? -176.57 131.97 69 9 ALA A 3 ? ? -101.02 76.10 70 9 ALA A 4 ? ? 63.45 -80.72 71 9 GLU A 5 ? ? 165.39 64.86 72 9 THR A 13 ? ? -134.38 -35.06 73 9 LYS A 35 ? ? -174.51 89.11 74 10 ALA A 4 ? ? -113.94 -75.27 75 10 GLU A 5 ? ? 165.49 64.88 76 10 LYS A 8 ? ? -179.22 84.87 77 10 THR A 13 ? ? -134.43 -35.01 78 10 HIS A 32 ? ? -100.44 45.39 79 10 LYS A 33 ? ? -144.89 44.16 80 10 ASN A 34 ? ? -174.28 36.31 81 10 LYS A 35 ? ? -177.44 87.75 82 11 SER A 2 ? ? -150.47 84.03 83 11 GLU A 5 ? ? 165.51 64.94 84 11 MET A 7 ? ? 64.64 179.92 85 11 LYS A 8 ? ? 77.21 -69.25 86 11 LYS A 9 ? ? -156.92 56.03 87 11 THR A 13 ? ? -134.33 -35.10 88 11 HIS A 32 ? ? -95.36 42.73 89 11 LYS A 33 ? ? -165.35 44.47 90 11 ASN A 34 ? ? -167.97 33.71 91 12 GLU A 5 ? ? 165.43 64.91 92 12 LYS A 9 ? ? 70.45 49.25 93 13 ALA A 3 ? ? 60.63 92.32 94 13 GLU A 5 ? ? 165.59 64.94 95 13 LYS A 8 ? ? -96.55 -78.77 96 13 LYS A 9 ? ? -152.07 50.58 97 13 THR A 13 ? ? -134.40 -35.02 98 13 ASN A 34 ? ? 52.09 72.11 99 13 LYS A 35 ? ? 60.45 96.71 100 14 ALA A 3 ? ? 60.37 98.77 101 14 GLU A 5 ? ? 165.45 65.00 102 14 VAL A 6 ? ? -58.08 108.77 103 14 MET A 7 ? ? -176.68 145.98 104 14 LYS A 8 ? ? -54.97 -175.00 105 14 HIS A 32 ? ? -115.85 53.05 106 15 ALA A 3 ? ? 61.15 113.46 107 15 ALA A 4 ? ? 61.41 -169.85 108 15 GLU A 5 ? ? 165.48 65.04 109 15 THR A 13 ? ? -134.41 -35.02 110 15 LYS A 33 ? ? 174.78 72.02 111 16 SER A 2 ? ? -98.33 35.63 112 16 ALA A 4 ? ? 68.67 -67.64 113 16 GLU A 5 ? ? 165.55 64.97 114 16 MET A 7 ? ? 66.13 123.02 115 16 LYS A 9 ? ? -156.27 62.05 116 16 THR A 13 ? ? -134.28 -35.02 117 16 HIS A 32 ? ? -109.43 49.50 118 16 LYS A 33 ? ? -155.15 44.00 119 16 ASN A 34 ? ? -166.71 77.98 120 16 LYS A 35 ? ? 60.66 78.94 121 17 SER A 2 ? ? -98.95 32.10 122 17 ALA A 3 ? ? -174.37 36.81 123 17 ALA A 4 ? ? 60.51 165.02 124 17 GLU A 5 ? ? 165.40 64.88 125 17 MET A 7 ? ? -176.52 142.59 126 17 LYS A 8 ? ? -150.61 -63.55 127 17 LYS A 9 ? ? -168.95 65.02 128 17 THR A 13 ? ? -134.43 -34.91 129 17 HIS A 32 ? ? -95.76 42.41 130 17 LYS A 33 ? ? -171.58 44.44 131 17 ASN A 34 ? ? -169.38 49.01 132 17 LYS A 35 ? ? 62.47 80.15 133 18 ALA A 3 ? ? -166.01 33.69 134 18 ALA A 4 ? ? 60.86 156.02 135 18 GLU A 5 ? ? 165.50 64.97 136 18 LYS A 9 ? ? -167.90 67.51 137 18 THR A 13 ? ? -134.38 -35.05 138 18 HIS A 32 ? ? -100.35 45.27 139 18 LYS A 35 ? ? 60.66 75.90 140 19 SER A 2 ? ? 60.56 162.07 141 19 ALA A 3 ? ? -97.05 40.59 142 19 ALA A 4 ? ? 64.49 -78.64 143 19 GLU A 5 ? ? 165.51 64.97 144 19 VAL A 6 ? ? -94.89 39.90 145 19 MET A 7 ? ? -176.50 121.12 146 19 LYS A 8 ? ? -151.62 -46.76 147 19 LYS A 9 ? ? -170.95 44.25 148 19 THR A 13 ? ? -134.31 -35.09 149 19 HIS A 32 ? ? -111.84 50.41 150 19 LYS A 33 ? ? -161.49 43.69 151 19 ASN A 34 ? ? -168.55 33.88 152 20 ALA A 3 ? ? -165.23 36.27 153 20 GLU A 5 ? ? 165.52 64.92 154 20 VAL A 6 ? ? -95.46 38.44 155 20 LYS A 8 ? ? -176.35 -38.05 156 20 THR A 13 ? ? -134.33 -35.12 157 20 HIS A 32 ? ? -105.35 48.06 158 20 LYS A 35 ? ? -171.69 55.07 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #