data_1JY4 # _entry.id 1JY4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1JY4 pdb_00001jy4 10.2210/pdb1jy4/pdb RCSB RCSB014320 ? ? WWPDB D_1000014320 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1JY6 _pdbx_database_related.details 'B4DIMERA: A DE NOVO DESIGNED FOUR-STRANDED BETA-SHEET ASSEMBLED USING A DISULFIDE BOND' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1JY4 _pdbx_database_status.recvd_initial_deposition_date 2001-09-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Venkatraman, J.' 1 'Nagana Gowda, G.A.' 2 'Balaram, P.' 3 # _citation.id primary _citation.title 'Design and construction of an open multistranded beta-sheet polypeptide stabilized by a disulfide bridge.' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 124 _citation.page_first 4987 _citation.page_last 4994 _citation.year 2002 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11982362 _citation.pdbx_database_id_DOI 10.1021/ja0174276 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Venkatraman, J.' 1 ? primary 'Nagana Gowda, G.A.' 2 ? primary 'Balaram, P.' 3 ? # _cell.entry_id 1JY4 _cell.length_a ? _cell.length_b ? _cell.length_c ? _cell.angle_alpha ? _cell.angle_beta ? _cell.angle_gamma ? _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description B4DIMER _entity.formula_weight 3937.633 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'RGECKFTV(DPR)GRTALNT(DPR)AVQKWHFVL(DPR)GYKCEILA' _entity_poly.pdbx_seq_one_letter_code_can RGECKFTVPGRTALNTPAVQKWHFVLPGYKCEILA _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 GLY n 1 3 GLU n 1 4 CYS n 1 5 LYS n 1 6 PHE n 1 7 THR n 1 8 VAL n 1 9 DPR n 1 10 GLY n 1 11 ARG n 1 12 THR n 1 13 ALA n 1 14 LEU n 1 15 ASN n 1 16 THR n 1 17 DPR n 1 18 ALA n 1 19 VAL n 1 20 GLN n 1 21 LYS n 1 22 TRP n 1 23 HIS n 1 24 PHE n 1 25 VAL n 1 26 LEU n 1 27 DPR n 1 28 GLY n 1 29 TYR n 1 30 LYS n 1 31 CYS n 1 32 GLU n 1 33 ILE n 1 34 LEU n 1 35 ALA n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was chemically synthesized.' # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 1JY4 _struct_ref.pdbx_db_accession 1JY4 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1JY4 A 1 ? 35 ? 1JY4 1 ? 35 ? 1 35 2 1 1JY4 B 1 ? 35 ? 1JY4 1 ? 35 ? 1 35 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DPR 'D-peptide linking' . D-PROLINE ? 'C5 H9 N O2' 115.130 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 DQF-COSY 3 1 1 TOCSY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH ? _pdbx_nmr_exptl_sample_conditions.ionic_strength unbuffered _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM B4dimer, CD3OH' _pdbx_nmr_sample_details.solvent_system CD3OH # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 1JY4 _pdbx_nmr_refine.method ;torsion angle dynamics/ simulated annealing ; _pdbx_nmr_refine.details ;The ten structures were determined by NMR and torsion angle dynamics/simulated annealing methods. The peptide dimer was treated as a single entity and symmetry elements were not utilized during structure calculations. The structures are based on a total of 446 restraints, 398 are NOE-derived distance constraints,48 distance restraints are from hydrogen bonds. The list of constraints is available in the file dyana_upperconst.txt. Structure calculations were performed with the program DYANA-1.5 (P. Guentert, C. Mumenthaler, K. Wuthrich, J. Mol. Biol.(1997)Vol.273, 283-298). No violation of distance constraints from NOEs exceeded 0.3Angstroms. The ensemble of structures is superimposed over the best-structured region encompasing residues E11-L34. The average RMSDs between the superposed structures and the average structure are as follows: 0.75(chain A, residues 11-34, backbone atoms) 0.72(chain B, residues 11-34, backbone atoms. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1JY4 _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1JY4 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1JY4 _pdbx_nmr_representative.conformer_id 8 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA 1.5 'structure solution' Guentert 1 DYANA 1.5 refinement Guentert 2 # _exptl.entry_id 1JY4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1JY4 _struct.title 'B4DIMER: A DE NOVO DESIGNED EIGHT-STRANDED BETA-SHEET ASSEMBLED USING A DISULFIDE BOND' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1JY4 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'eight-stranded beta-sheet, disulfide bond, de novo protein design, DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 31 SG ? ? ? 1_555 B CYS 31 SG ? ? A CYS 31 B CYS 31 1_555 ? ? ? ? ? ? ? 1.997 ? ? covale1 covale both ? A VAL 8 C ? ? ? 1_555 A DPR 9 N ? ? A VAL 8 A DPR 9 1_555 ? ? ? ? ? ? ? 1.360 ? ? covale2 covale both ? A DPR 9 C ? ? ? 1_555 A GLY 10 N ? ? A DPR 9 A GLY 10 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale3 covale both ? A THR 16 C ? ? ? 1_555 A DPR 17 N ? ? A THR 16 A DPR 17 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale4 covale both ? A DPR 17 C ? ? ? 1_555 A ALA 18 N ? ? A DPR 17 A ALA 18 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale5 covale both ? A LEU 26 C ? ? ? 1_555 A DPR 27 N ? ? A LEU 26 A DPR 27 1_555 ? ? ? ? ? ? ? 1.359 ? ? covale6 covale both ? A DPR 27 C ? ? ? 1_555 A GLY 28 N ? ? A DPR 27 A GLY 28 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? B VAL 8 C ? ? ? 1_555 B DPR 9 N ? ? B VAL 8 B DPR 9 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale8 covale both ? B DPR 9 C ? ? ? 1_555 B GLY 10 N ? ? B DPR 9 B GLY 10 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale9 covale both ? B THR 16 C ? ? ? 1_555 B DPR 17 N ? ? B THR 16 B DPR 17 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale10 covale both ? B DPR 17 C ? ? ? 1_555 B ALA 18 N ? ? B DPR 17 B ALA 18 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale11 covale both ? B LEU 26 C ? ? ? 1_555 B DPR 27 N ? ? B LEU 26 B DPR 27 1_555 ? ? ? ? ? ? ? 1.361 ? ? covale12 covale both ? B DPR 27 C ? ? ? 1_555 B GLY 28 N ? ? B DPR 27 B GLY 28 1_555 ? ? ? ? ? ? ? 1.323 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 5 ? VAL A 8 ? LYS A 5 VAL A 8 A 2 ARG A 11 ? THR A 16 ? ARG A 11 THR A 16 A 3 VAL A 19 ? LEU A 26 ? VAL A 19 LEU A 26 A 4 TYR A 29 ? ALA A 35 ? TYR A 29 ALA A 35 A 5 TYR B 29 ? ALA B 35 ? TYR B 29 ALA B 35 A 6 VAL B 19 ? LEU B 26 ? VAL B 19 LEU B 26 A 7 ARG B 11 ? THR B 16 ? ARG B 11 THR B 16 A 8 LYS B 5 ? VAL B 8 ? LYS B 5 VAL B 8 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 6 ? N PHE A 6 O ALA A 13 ? O ALA A 13 A 2 3 N THR A 16 ? N THR A 16 O VAL A 19 ? O VAL A 19 A 3 4 N PHE A 24 ? N PHE A 24 O CYS A 31 ? O CYS A 31 A 4 5 N LYS A 30 ? N LYS A 30 O GLU B 32 ? O GLU B 32 A 5 6 O ALA B 35 ? O ALA B 35 N GLN B 20 ? N GLN B 20 A 6 7 O HIS B 23 ? O HIS B 23 N THR B 12 ? N THR B 12 A 7 8 O ARG B 11 ? O ARG B 11 N VAL B 8 ? N VAL B 8 # _database_PDB_matrix.entry_id 1JY4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1JY4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 DPR 9 9 9 DPR DPR A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 DPR 17 17 17 DPR DPR A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 TRP 22 22 22 TRP TRP A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 DPR 27 27 27 DPR DPR A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ALA 35 35 35 ALA ALA A . n B 1 1 ARG 1 1 1 ARG ARG B . n B 1 2 GLY 2 2 2 GLY GLY B . n B 1 3 GLU 3 3 3 GLU GLU B . n B 1 4 CYS 4 4 4 CYS CYS B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 PHE 6 6 6 PHE PHE B . n B 1 7 THR 7 7 7 THR THR B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 DPR 9 9 9 DPR DPR B . n B 1 10 GLY 10 10 10 GLY GLY B . n B 1 11 ARG 11 11 11 ARG ARG B . n B 1 12 THR 12 12 12 THR THR B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 ASN 15 15 15 ASN ASN B . n B 1 16 THR 16 16 16 THR THR B . n B 1 17 DPR 17 17 17 DPR DPR B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 GLN 20 20 20 GLN GLN B . n B 1 21 LYS 21 21 21 LYS LYS B . n B 1 22 TRP 22 22 22 TRP TRP B . n B 1 23 HIS 23 23 23 HIS HIS B . n B 1 24 PHE 24 24 24 PHE PHE B . n B 1 25 VAL 25 25 25 VAL VAL B . n B 1 26 LEU 26 26 26 LEU LEU B . n B 1 27 DPR 27 27 27 DPR DPR B . n B 1 28 GLY 28 28 28 GLY GLY B . n B 1 29 TYR 29 29 29 TYR TYR B . n B 1 30 LYS 30 30 30 LYS LYS B . n B 1 31 CYS 31 31 31 CYS CYS B . n B 1 32 GLU 32 32 32 GLU GLU B . n B 1 33 ILE 33 33 33 ILE ILE B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 ALA 35 35 35 ALA ALA B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A DPR 9 A DPR 9 ? PRO D-PROLINE 2 A DPR 17 A DPR 17 ? PRO D-PROLINE 3 A DPR 27 A DPR 27 ? PRO D-PROLINE 4 B DPR 9 B DPR 9 ? PRO D-PROLINE 5 B DPR 17 B DPR 17 ? PRO D-PROLINE 6 B DPR 27 B DPR 27 ? PRO D-PROLINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-12 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 GLU A 3 ? ? -154.44 35.09 2 2 LYS A 5 ? ? -111.15 -140.11 3 2 VAL A 25 ? ? -116.65 79.25 4 2 LEU A 34 ? ? -117.78 67.22 5 3 GLU B 3 ? ? -116.09 65.89 6 3 LYS B 5 ? ? -119.48 -141.47 7 4 DPR A 9 ? ? 74.95 -27.40 8 4 LEU A 34 ? ? -115.94 56.85 9 4 ALA B 18 ? ? 91.54 17.60 10 5 GLU A 3 ? ? -116.26 73.72 11 5 CYS A 4 ? ? -150.03 42.57 12 5 CYS B 4 ? ? -119.64 63.93 13 5 DPR B 9 ? ? 74.85 -23.08 14 6 DPR A 9 ? ? 75.06 -30.42 15 6 ALA A 18 ? ? -160.65 27.55 16 6 LEU A 26 ? ? -150.60 89.34 17 6 CYS B 4 ? ? -115.70 75.64 18 6 DPR B 17 ? ? 74.97 -31.96 19 6 ALA B 18 ? ? 162.30 -27.97 20 7 ALA A 18 ? ? 91.14 21.68 21 7 LEU A 34 ? ? -109.99 53.96 22 7 LEU B 34 ? ? -114.41 67.92 23 8 GLU A 3 ? ? -117.50 67.94 24 9 THR A 7 ? ? -118.15 65.88 #