data_1K2N # _entry.id 1K2N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K2N pdb_00001k2n 10.2210/pdb1k2n/pdb RCSB RCSB014483 ? ? WWPDB D_1000014483 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-12-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K2N _pdbx_database_status.recvd_initial_deposition_date 2001-09-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1K2M '1K2M contains the same protein (FHA2) complexed with a pTyr peptide.' unspecified PDB 1FHR '1FHR contains the same protein (FHA2) complexed with a pTyr peptide.' unspecified PDB 1FHQ '1FHQ contains the same protein (FHA2) in a peptide-free state.' unspecified PDB 1DMZ '1DMZ contains the same protein (FHA2) in a peptide-free state.' unspecified PDB 1QU5 '1QU5 contains the same protein (FHA2) in a peptide-free state.' unspecified PDB 1J4K '1J4K CONTAINS THE MINIMIZED AVERAGE STRUCTURE FOR the same protein (FHA2) complexed with a pTyr peptide.' unspecified PDB 1J4L '1J4L CONTAINS THE MINIMIZED AVERAGE STRUCTURE FOR THIS ENSEMBLE.' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Byeon, I.-J.L.' 1 'Yongkiettrakul, S.' 2 'Tsai, M.-D.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes. ; J.Mol.Biol. 314 577 588 2001 JMOBAK UK 0022-2836 0070 ? 11846568 10.1006/jmbi.2001.5141 1 'II. Structure and Specificity of the Interaction between the FHA2 Domain of Rad53 and Phosphotyrosyl Peptides.' J.Mol.Biol. 302 927 940 2000 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.2000.4095 2 'Structure and Function of a New Phosphopeptide-binding Domain Containing the FHA2 of Rad53.' J.Mol.Biol. 294 1041 1049 1999 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1999.3313 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Byeon, I.J.' 1 ? primary 'Yongkiettrakul, S.' 2 ? primary 'Tsai, M.D.' 3 ? 1 'Wang, P.' 4 ? 1 'Byeon, I.J.' 5 ? 1 'Liao, H.' 6 ? 1 'Beebe, K.D.' 7 ? 1 'Yongkiettrakul, S.' 8 ? 1 'Pei, D.' 9 ? 1 'Tsai, M.D.' 10 ? 2 'Liao, H.' 11 ? 2 'Byeon, I.J.' 12 ? 2 'Tsai, M.D.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein Kinase SPK1' 18148.758 1 2.7.1.- ? 'C-terminal FHA domain (FHA2)' ? 2 polymer syn 'DNA repair protein Rad9' 1137.130 1 ? ? 'Residues 599-607' ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; A ? 2 'polypeptide(L)' no yes 'EVEL(TPO)QELP' EVELTQELP P ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ASN n 1 3 GLY n 1 4 ARG n 1 5 PHE n 1 6 LEU n 1 7 THR n 1 8 LEU n 1 9 LYS n 1 10 PRO n 1 11 LEU n 1 12 PRO n 1 13 ASP n 1 14 SER n 1 15 ILE n 1 16 ILE n 1 17 GLN n 1 18 GLU n 1 19 SER n 1 20 LEU n 1 21 GLU n 1 22 ILE n 1 23 GLN n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ASN n 1 28 PRO n 1 29 PHE n 1 30 PHE n 1 31 ILE n 1 32 GLY n 1 33 ARG n 1 34 SER n 1 35 GLU n 1 36 ASP n 1 37 CYS n 1 38 ASN n 1 39 CYS n 1 40 LYS n 1 41 ILE n 1 42 GLU n 1 43 ASP n 1 44 ASN n 1 45 ARG n 1 46 LEU n 1 47 SER n 1 48 ARG n 1 49 VAL n 1 50 HIS n 1 51 CYS n 1 52 PHE n 1 53 ILE n 1 54 PHE n 1 55 LYS n 1 56 LYS n 1 57 ARG n 1 58 HIS n 1 59 ALA n 1 60 VAL n 1 61 GLY n 1 62 LYS n 1 63 SER n 1 64 MET n 1 65 TYR n 1 66 GLU n 1 67 SER n 1 68 PRO n 1 69 ALA n 1 70 GLN n 1 71 GLY n 1 72 LEU n 1 73 ASP n 1 74 ASP n 1 75 ILE n 1 76 TRP n 1 77 TYR n 1 78 CYS n 1 79 HIS n 1 80 THR n 1 81 GLY n 1 82 THR n 1 83 ASN n 1 84 VAL n 1 85 SER n 1 86 TYR n 1 87 LEU n 1 88 ASN n 1 89 ASN n 1 90 ASN n 1 91 ARG n 1 92 MET n 1 93 ILE n 1 94 GLN n 1 95 GLY n 1 96 THR n 1 97 LYS n 1 98 PHE n 1 99 LEU n 1 100 LEU n 1 101 GLN n 1 102 ASP n 1 103 GLY n 1 104 ASP n 1 105 GLU n 1 106 ILE n 1 107 LYS n 1 108 ILE n 1 109 ILE n 1 110 TRP n 1 111 ASP n 1 112 LYS n 1 113 ASN n 1 114 ASN n 1 115 LYS n 1 116 PHE n 1 117 VAL n 1 118 ILE n 1 119 GLY n 1 120 PHE n 1 121 LYS n 1 122 VAL n 1 123 GLU n 1 124 ILE n 1 125 ASN n 1 126 ASP n 1 127 THR n 1 128 THR n 1 129 GLY n 1 130 LEU n 1 131 PHE n 1 132 ASN n 1 133 GLU n 1 134 GLY n 1 135 LEU n 1 136 GLY n 1 137 MET n 1 138 LEU n 1 139 GLN n 1 140 GLU n 1 141 GLN n 1 142 ARG n 1 143 VAL n 1 144 VAL n 1 145 LEU n 1 146 LYS n 1 147 GLN n 1 148 THR n 1 149 ALA n 1 150 GLU n 1 151 GLU n 1 152 LYS n 1 153 ASP n 1 154 LEU n 1 155 VAL n 1 156 LYS n 1 157 LYS n 1 158 LEU n 2 1 GLU n 2 2 VAL n 2 3 GLU n 2 4 LEU n 2 5 TPO n 2 6 GLN n 2 7 GLU n 2 8 LEU n 2 9 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene 'SPK1 or RAD53' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-4T _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'This phosphothreonyl peptide was chemically synthesized.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 573 573 GLY GLY A . n A 1 2 ASN 2 574 574 ASN ASN A . n A 1 3 GLY 3 575 575 GLY GLY A . n A 1 4 ARG 4 576 576 ARG ARG A . n A 1 5 PHE 5 577 577 PHE PHE A . n A 1 6 LEU 6 578 578 LEU LEU A . n A 1 7 THR 7 579 579 THR THR A . n A 1 8 LEU 8 580 580 LEU LEU A . n A 1 9 LYS 9 581 581 LYS LYS A . n A 1 10 PRO 10 582 582 PRO PRO A . n A 1 11 LEU 11 583 583 LEU LEU A . n A 1 12 PRO 12 584 584 PRO PRO A . n A 1 13 ASP 13 585 585 ASP ASP A . n A 1 14 SER 14 586 586 SER SER A . n A 1 15 ILE 15 587 587 ILE ILE A . n A 1 16 ILE 16 588 588 ILE ILE A . n A 1 17 GLN 17 589 589 GLN GLN A . n A 1 18 GLU 18 590 590 GLU GLU A . n A 1 19 SER 19 591 591 SER SER A . n A 1 20 LEU 20 592 592 LEU LEU A . n A 1 21 GLU 21 593 593 GLU GLU A . n A 1 22 ILE 22 594 594 ILE ILE A . n A 1 23 GLN 23 595 595 GLN GLN A . n A 1 24 GLN 24 596 596 GLN GLN A . n A 1 25 GLY 25 597 597 GLY GLY A . n A 1 26 VAL 26 598 598 VAL VAL A . n A 1 27 ASN 27 599 599 ASN ASN A . n A 1 28 PRO 28 600 600 PRO PRO A . n A 1 29 PHE 29 601 601 PHE PHE A . n A 1 30 PHE 30 602 602 PHE PHE A . n A 1 31 ILE 31 603 603 ILE ILE A . n A 1 32 GLY 32 604 604 GLY GLY A . n A 1 33 ARG 33 605 605 ARG ARG A . n A 1 34 SER 34 606 606 SER SER A . n A 1 35 GLU 35 607 607 GLU GLU A . n A 1 36 ASP 36 608 608 ASP ASP A . n A 1 37 CYS 37 609 609 CYS CYS A . n A 1 38 ASN 38 610 610 ASN ASN A . n A 1 39 CYS 39 611 611 CYS CYS A . n A 1 40 LYS 40 612 612 LYS LYS A . n A 1 41 ILE 41 613 613 ILE ILE A . n A 1 42 GLU 42 614 614 GLU GLU A . n A 1 43 ASP 43 615 615 ASP ASP A . n A 1 44 ASN 44 616 616 ASN ASN A . n A 1 45 ARG 45 617 617 ARG ARG A . n A 1 46 LEU 46 618 618 LEU LEU A . n A 1 47 SER 47 619 619 SER SER A . n A 1 48 ARG 48 620 620 ARG ARG A . n A 1 49 VAL 49 621 621 VAL VAL A . n A 1 50 HIS 50 622 622 HIS HIS A . n A 1 51 CYS 51 623 623 CYS CYS A . n A 1 52 PHE 52 624 624 PHE PHE A . n A 1 53 ILE 53 625 625 ILE ILE A . n A 1 54 PHE 54 626 626 PHE PHE A . n A 1 55 LYS 55 627 627 LYS LYS A . n A 1 56 LYS 56 628 628 LYS LYS A . n A 1 57 ARG 57 629 629 ARG ARG A . n A 1 58 HIS 58 630 630 HIS HIS A . n A 1 59 ALA 59 631 631 ALA ALA A . n A 1 60 VAL 60 632 632 VAL VAL A . n A 1 61 GLY 61 633 633 GLY GLY A . n A 1 62 LYS 62 634 634 LYS LYS A . n A 1 63 SER 63 635 635 SER SER A . n A 1 64 MET 64 636 636 MET MET A . n A 1 65 TYR 65 637 637 TYR TYR A . n A 1 66 GLU 66 638 638 GLU GLU A . n A 1 67 SER 67 639 639 SER SER A . n A 1 68 PRO 68 640 640 PRO PRO A . n A 1 69 ALA 69 641 641 ALA ALA A . n A 1 70 GLN 70 642 642 GLN GLN A . n A 1 71 GLY 71 643 643 GLY GLY A . n A 1 72 LEU 72 644 644 LEU LEU A . n A 1 73 ASP 73 645 645 ASP ASP A . n A 1 74 ASP 74 646 646 ASP ASP A . n A 1 75 ILE 75 647 647 ILE ILE A . n A 1 76 TRP 76 648 648 TRP TRP A . n A 1 77 TYR 77 649 649 TYR TYR A . n A 1 78 CYS 78 650 650 CYS CYS A . n A 1 79 HIS 79 651 651 HIS HIS A . n A 1 80 THR 80 652 652 THR THR A . n A 1 81 GLY 81 653 653 GLY GLY A . n A 1 82 THR 82 654 654 THR THR A . n A 1 83 ASN 83 655 655 ASN ASN A . n A 1 84 VAL 84 656 656 VAL VAL A . n A 1 85 SER 85 657 657 SER SER A . n A 1 86 TYR 86 658 658 TYR TYR A . n A 1 87 LEU 87 659 659 LEU LEU A . n A 1 88 ASN 88 660 660 ASN ASN A . n A 1 89 ASN 89 661 661 ASN ASN A . n A 1 90 ASN 90 662 662 ASN ASN A . n A 1 91 ARG 91 663 663 ARG ARG A . n A 1 92 MET 92 664 664 MET MET A . n A 1 93 ILE 93 665 665 ILE ILE A . n A 1 94 GLN 94 666 666 GLN GLN A . n A 1 95 GLY 95 667 667 GLY GLY A . n A 1 96 THR 96 668 668 THR THR A . n A 1 97 LYS 97 669 669 LYS LYS A . n A 1 98 PHE 98 670 670 PHE PHE A . n A 1 99 LEU 99 671 671 LEU LEU A . n A 1 100 LEU 100 672 672 LEU LEU A . n A 1 101 GLN 101 673 673 GLN GLN A . n A 1 102 ASP 102 674 674 ASP ASP A . n A 1 103 GLY 103 675 675 GLY GLY A . n A 1 104 ASP 104 676 676 ASP ASP A . n A 1 105 GLU 105 677 677 GLU GLU A . n A 1 106 ILE 106 678 678 ILE ILE A . n A 1 107 LYS 107 679 679 LYS LYS A . n A 1 108 ILE 108 680 680 ILE ILE A . n A 1 109 ILE 109 681 681 ILE ILE A . n A 1 110 TRP 110 682 682 TRP TRP A . n A 1 111 ASP 111 683 683 ASP ASP A . n A 1 112 LYS 112 684 684 LYS LYS A . n A 1 113 ASN 113 685 685 ASN ASN A . n A 1 114 ASN 114 686 686 ASN ASN A . n A 1 115 LYS 115 687 687 LYS LYS A . n A 1 116 PHE 116 688 688 PHE PHE A . n A 1 117 VAL 117 689 689 VAL VAL A . n A 1 118 ILE 118 690 690 ILE ILE A . n A 1 119 GLY 119 691 691 GLY GLY A . n A 1 120 PHE 120 692 692 PHE PHE A . n A 1 121 LYS 121 693 693 LYS LYS A . n A 1 122 VAL 122 694 694 VAL VAL A . n A 1 123 GLU 123 695 695 GLU GLU A . n A 1 124 ILE 124 696 696 ILE ILE A . n A 1 125 ASN 125 697 697 ASN ASN A . n A 1 126 ASP 126 698 698 ASP ASP A . n A 1 127 THR 127 699 699 THR THR A . n A 1 128 THR 128 700 700 THR THR A . n A 1 129 GLY 129 701 701 GLY GLY A . n A 1 130 LEU 130 702 702 LEU LEU A . n A 1 131 PHE 131 703 703 PHE PHE A . n A 1 132 ASN 132 704 704 ASN ASN A . n A 1 133 GLU 133 705 705 GLU GLU A . n A 1 134 GLY 134 706 706 GLY GLY A . n A 1 135 LEU 135 707 707 LEU LEU A . n A 1 136 GLY 136 708 708 GLY GLY A . n A 1 137 MET 137 709 709 MET MET A . n A 1 138 LEU 138 710 710 LEU LEU A . n A 1 139 GLN 139 711 711 GLN GLN A . n A 1 140 GLU 140 712 712 GLU GLU A . n A 1 141 GLN 141 713 713 GLN GLN A . n A 1 142 ARG 142 714 714 ARG ARG A . n A 1 143 VAL 143 715 715 VAL VAL A . n A 1 144 VAL 144 716 716 VAL VAL A . n A 1 145 LEU 145 717 717 LEU LEU A . n A 1 146 LYS 146 718 718 LYS LYS A . n A 1 147 GLN 147 719 719 GLN GLN A . n A 1 148 THR 148 720 720 THR THR A . n A 1 149 ALA 149 721 721 ALA ALA A . n A 1 150 GLU 150 722 722 GLU GLU A . n A 1 151 GLU 151 723 723 GLU GLU A . n A 1 152 LYS 152 724 724 LYS LYS A . n A 1 153 ASP 153 725 725 ASP ASP A . n A 1 154 LEU 154 726 726 LEU LEU A . n A 1 155 VAL 155 727 727 VAL VAL A . n A 1 156 LYS 156 728 728 LYS LYS A . n A 1 157 LYS 157 729 729 LYS LYS A . n A 1 158 LEU 158 730 730 LEU LEU A . n B 2 1 GLU 1 599 599 GLU GLU P . n B 2 2 VAL 2 600 600 VAL VAL P . n B 2 3 GLU 3 601 601 GLU GLU P . n B 2 4 LEU 4 602 602 LEU LEU P . n B 2 5 TPO 5 603 603 TPO TPO P . n B 2 6 GLN 6 604 604 GLN GLN P . n B 2 7 GLU 7 605 605 GLU GLU P . n B 2 8 LEU 8 606 606 LEU LEU P . n B 2 9 PRO 9 607 607 PRO PRO P . n # _exptl.entry_id 1K2N _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1K2N _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K2N _struct.title 'Solution Structure of the FHA2 domain of Rad53 Complexed with a Phosphothreonyl Peptide Derived from Rad9' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K2N _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'FHA domain, Rad53, Rad9, Phosphothreonine, Phosphoprotein, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP RAD53_YEAST 1 ;GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHT GTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL ; 573 P22216 ? 2 UNP RAD9_YEAST 2 EVELTQELP 599 P14737 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1K2N A 1 ? 158 ? P22216 573 ? 730 ? 573 730 2 2 1K2N P 1 ? 9 ? P14737 599 ? 607 ? 599 607 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 1K2N _struct_ref_seq_dif.mon_id TPO _struct_ref_seq_dif.pdbx_pdb_strand_id P _struct_ref_seq_dif.seq_num 5 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P14737 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 603 _struct_ref_seq_dif.details 'modified residue' _struct_ref_seq_dif.pdbx_auth_seq_num 603 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 148 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 157 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 720 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 729 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B LEU 4 C ? ? ? 1_555 B TPO 5 N ? ? P LEU 602 P TPO 603 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? B TPO 5 C ? ? ? 1_555 B GLN 6 N ? ? P TPO 603 P GLN 604 1_555 ? ? ? ? ? ? ? 1.329 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id TPO _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 5 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id TPO _pdbx_modification_feature.auth_asym_id P _pdbx_modification_feature.auth_seq_id 603 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id THR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id TPO _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 1 -0.10 2 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 2 0.06 3 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 3 0.10 4 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 4 -0.24 5 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 5 0.32 6 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 6 -0.04 7 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 7 0.06 8 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 8 -0.29 9 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 9 0.21 10 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 10 -0.50 11 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 11 -0.45 12 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 12 -0.89 13 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 13 -0.13 14 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 14 -0.01 15 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 15 -0.53 16 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 16 -0.05 17 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 17 0.51 18 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 18 -0.35 19 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 19 -0.44 20 ASN 27 A . ? ASN 599 A PRO 28 A ? PRO 600 A 20 -0.59 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 20 ? ILE A 22 ? LEU A 592 ILE A 594 A 2 LEU A 6 ? PRO A 10 ? LEU A 578 PRO A 582 A 3 VAL A 117 ? ILE A 124 ? VAL A 689 ILE A 696 A 4 ASP A 104 ? TRP A 110 ? ASP A 676 TRP A 682 A 5 SER A 85 ? LEU A 87 ? SER A 657 LEU A 659 A 6 ASN A 90 ? MET A 92 ? ASN A 662 MET A 664 B 1 CYS A 39 ? LYS A 40 ? CYS A 611 LYS A 612 B 2 PHE A 29 ? GLY A 32 ? PHE A 601 GLY A 604 B 3 CYS A 51 ? ARG A 57 ? CYS A 623 ARG A 629 B 4 ASP A 73 ? HIS A 79 ? ASP A 645 HIS A 651 B 5 THR A 96 ? LEU A 99 ? THR A 668 LEU A 671 B 6 LEU A 145 ? LYS A 146 ? LEU A 717 LYS A 718 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 20 ? O LEU A 592 N LEU A 8 ? N LEU A 580 A 2 3 N THR A 7 ? N THR A 579 O GLU A 123 ? O GLU A 695 A 3 4 O VAL A 122 ? O VAL A 694 N ASP A 104 ? N ASP A 676 A 4 5 O LYS A 107 ? O LYS A 679 N TYR A 86 ? N TYR A 658 A 5 6 N LEU A 87 ? N LEU A 659 O ASN A 90 ? O ASN A 662 B 1 2 O CYS A 39 ? O CYS A 611 N GLY A 32 ? N GLY A 604 B 2 3 N PHE A 29 ? N PHE A 601 O ILE A 53 ? O ILE A 625 B 3 4 N LYS A 56 ? N LYS A 628 O ASP A 74 ? O ASP A 646 B 4 5 N TYR A 77 ? N TYR A 649 O PHE A 98 ? O PHE A 670 B 5 6 N LYS A 97 ? N LYS A 669 O LEU A 145 ? O LEU A 717 # _pdbx_entry_details.entry_id 1K2N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.52 2 1 O A LYS 628 ? ? H A ASP 646 ? ? 1.54 3 1 O A TYR 658 ? ? H A LYS 679 ? ? 1.56 4 1 H A TYR 649 ? ? O A PHE 670 ? ? 1.56 5 1 O A ASP 676 ? ? H A VAL 694 ? ? 1.58 6 1 O A PHE 602 ? ? H A CYS 611 ? ? 1.58 7 1 O A LEU 580 ? ? H A LEU 592 ? ? 1.58 8 2 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 9 2 O A PHE 626 ? ? H A TRP 648 ? ? 1.57 10 2 H A PHE 626 ? ? O A TRP 648 ? ? 1.57 11 2 H A TYR 649 ? ? O A PHE 670 ? ? 1.58 12 2 O A LYS 628 ? ? H A ASP 646 ? ? 1.58 13 2 O A GLN 595 ? ? H A VAL 598 ? ? 1.59 14 3 O A GLN 595 ? ? H A VAL 598 ? ? 1.48 15 3 O A LYS 628 ? ? H A ASP 646 ? ? 1.52 16 3 O A LEU 578 ? ? H A ILE 594 ? ? 1.55 17 3 H A PHE 626 ? ? O A TRP 648 ? ? 1.56 18 3 H A ILE 587 ? ? O A VAL 689 ? ? 1.56 19 3 H A TYR 658 ? ? O A LYS 679 ? ? 1.56 20 3 O A TYR 658 ? ? H A LYS 679 ? ? 1.60 21 4 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.51 22 4 O A THR 579 ? ? H A GLU 695 ? ? 1.51 23 4 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 24 4 O A ASP 676 ? ? H A VAL 694 ? ? 1.55 25 4 O A GLN 595 ? ? H A VAL 598 ? ? 1.55 26 4 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 27 4 O A TYR 658 ? ? H A LYS 679 ? ? 1.59 28 5 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 29 5 O A PHE 626 ? ? H A TRP 648 ? ? 1.55 30 5 O A LYS 628 ? ? H A ASP 646 ? ? 1.56 31 5 O A GLN 595 ? ? H A VAL 598 ? ? 1.56 32 6 O A GLN 595 ? ? H A VAL 598 ? ? 1.45 33 6 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.48 34 6 O A TYR 658 ? ? H A LYS 679 ? ? 1.54 35 6 H A PHE 626 ? ? O A TRP 648 ? ? 1.57 36 6 O A PHE 626 ? ? H A TRP 648 ? ? 1.59 37 7 O A LYS 628 ? ? H A ASP 646 ? ? 1.50 38 7 O A TYR 658 ? ? H A LYS 679 ? ? 1.52 39 7 H A LEU 580 ? ? O A LEU 592 ? ? 1.52 40 7 O A ASP 676 ? ? H A VAL 694 ? ? 1.58 41 7 O A PHE 602 ? ? H A CYS 611 ? ? 1.59 42 7 H A TYR 649 ? ? O A PHE 670 ? ? 1.60 43 8 H A PHE 626 ? ? O A TRP 648 ? ? 1.53 44 8 H A TYR 658 ? ? O A LYS 679 ? ? 1.54 45 8 O A LYS 628 ? ? H A ASP 646 ? ? 1.54 46 8 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 47 8 O A GLN 595 ? ? H A VAL 598 ? ? 1.56 48 8 H A TYR 649 ? ? O A PHE 670 ? ? 1.56 49 8 O A PHE 626 ? ? H A TRP 648 ? ? 1.58 50 8 H A LYS 669 ? ? O A LEU 717 ? ? 1.59 51 9 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 52 9 O A TYR 658 ? ? H A LYS 679 ? ? 1.50 53 9 H A TYR 649 ? ? O A PHE 670 ? ? 1.51 54 9 H A PHE 626 ? ? O A TRP 648 ? ? 1.53 55 9 O A GLN 595 ? ? H A VAL 598 ? ? 1.54 56 9 H A TYR 658 ? ? O A LYS 679 ? ? 1.58 57 9 O A PHE 602 ? ? H A CYS 611 ? ? 1.58 58 9 O A PHE 626 ? ? H A TRP 648 ? ? 1.60 59 10 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 60 10 O A GLN 595 ? ? H A VAL 598 ? ? 1.51 61 10 H A TYR 649 ? ? O A PHE 670 ? ? 1.52 62 10 O A TYR 658 ? ? H A LYS 679 ? ? 1.53 63 10 H A TYR 658 ? ? O A LYS 679 ? ? 1.53 64 10 O A ILE 681 ? ? H A ILE 690 ? ? 1.55 65 10 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 66 11 H A ASP 674 ? ? O A GLY 706 ? ? 1.49 67 11 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 68 11 O A THR 579 ? ? H A GLU 695 ? ? 1.54 69 11 H A PHE 626 ? ? O A TRP 648 ? ? 1.56 70 11 H A TYR 649 ? ? O A PHE 670 ? ? 1.57 71 11 O A TYR 658 ? ? H A LYS 679 ? ? 1.58 72 12 H A TYR 649 ? ? O A PHE 670 ? ? 1.48 73 12 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 74 12 O A TYR 658 ? ? H A LYS 679 ? ? 1.51 75 12 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.52 76 12 H A TYR 658 ? ? O A LYS 679 ? ? 1.57 77 12 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 78 12 O A ASP 676 ? ? H A VAL 694 ? ? 1.59 79 13 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 80 13 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 81 13 H A TYR 658 ? ? O A LYS 679 ? ? 1.58 82 13 O A LEU 580 ? ? H A LEU 592 ? ? 1.59 83 14 H A TYR 658 ? ? O A LYS 679 ? ? 1.54 84 14 O A LYS 628 ? ? H A ASP 646 ? ? 1.54 85 14 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 86 14 O A PHE 602 ? ? H A CYS 611 ? ? 1.56 87 14 H A TYR 649 ? ? O A PHE 670 ? ? 1.59 88 14 H A PHE 626 ? ? O A TRP 648 ? ? 1.60 89 15 H A TYR 658 ? ? O A LYS 679 ? ? 1.49 90 15 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.52 91 15 O A LEU 578 ? ? H A ILE 594 ? ? 1.52 92 15 O A TYR 658 ? ? H A LYS 679 ? ? 1.52 93 15 O A LYS 628 ? ? H A ASP 646 ? ? 1.53 94 15 O A PHE 602 ? ? H A CYS 611 ? ? 1.56 95 15 H A PHE 626 ? ? O A TRP 648 ? ? 1.57 96 15 O A PHE 626 ? ? H A TRP 648 ? ? 1.60 97 16 O A PHE 624 ? ? H A CYS 650 ? ? 1.47 98 16 H A TYR 658 ? ? O A LYS 679 ? ? 1.52 99 16 O A LYS 628 ? ? H A ASP 646 ? ? 1.52 100 16 O A TYR 658 ? ? H A LYS 679 ? ? 1.55 101 16 H A PHE 624 ? ? O A CYS 650 ? ? 1.55 102 16 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.57 103 16 O A ASP 676 ? ? H A VAL 694 ? ? 1.58 104 16 H A TYR 649 ? ? O A PHE 670 ? ? 1.60 105 16 O A GLN 595 ? ? H A VAL 598 ? ? 1.60 106 17 O A PHE 624 ? ? H A CYS 650 ? ? 1.48 107 17 H A TYR 649 ? ? O A PHE 670 ? ? 1.50 108 17 O A LYS 628 ? ? H A ASP 646 ? ? 1.51 109 17 H A PHE 624 ? ? O A CYS 650 ? ? 1.54 110 17 O A TYR 658 ? ? H A LYS 679 ? ? 1.60 111 18 O A LYS 628 ? ? H A ASP 646 ? ? 1.52 112 18 H A TYR 658 ? ? O A LYS 679 ? ? 1.53 113 18 O A LEU 580 ? ? H A LEU 592 ? ? 1.56 114 18 H A PHE 626 ? ? O A TRP 648 ? ? 1.57 115 18 O A ASP 676 ? ? H A VAL 694 ? ? 1.57 116 18 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.57 117 18 O A TYR 658 ? ? H A LYS 679 ? ? 1.60 118 18 O A THR 579 ? ? H A GLU 695 ? ? 1.60 119 19 O A LYS 628 ? ? H A ASP 646 ? ? 1.49 120 19 O A ILE 665 ? ? HG1 A THR 668 ? ? 1.54 121 19 O A LEU 580 ? ? H A LEU 592 ? ? 1.56 122 19 H A PHE 626 ? ? O A TRP 648 ? ? 1.56 123 19 H A TYR 658 ? ? O A LYS 679 ? ? 1.56 124 19 H A PHE 624 ? ? O A CYS 650 ? ? 1.58 125 19 O A PHE 626 ? ? H A TRP 648 ? ? 1.60 126 20 O A TYR 658 ? ? H A LYS 679 ? ? 1.49 127 20 O A LYS 628 ? ? H A ASP 646 ? ? 1.56 128 20 H A PHE 626 ? ? O A TRP 648 ? ? 1.58 129 20 O A LEU 580 ? ? H A LEU 592 ? ? 1.59 130 20 O A ASP 676 ? ? H A VAL 694 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 577 ? ? -122.43 -57.07 2 1 PRO A 582 ? ? -47.02 100.91 3 1 GLN A 589 ? ? -112.46 57.10 4 1 VAL A 621 ? ? -114.44 70.41 5 1 SER A 635 ? ? -151.11 55.99 6 1 MET A 636 ? ? -98.76 31.37 7 1 TYR A 637 ? ? -173.66 -66.75 8 1 PRO A 640 ? ? -78.34 -155.39 9 1 GLN A 642 ? ? 60.81 177.08 10 1 LEU A 644 ? ? -103.59 -150.25 11 1 VAL A 656 ? ? 78.55 142.25 12 1 ASN A 660 ? ? 61.19 -79.34 13 1 ASP A 674 ? ? -48.53 103.70 14 1 LYS A 687 ? ? 59.13 18.18 15 1 THR A 700 ? ? -67.25 71.13 16 1 ASN A 704 ? ? -165.54 -57.16 17 1 GLU A 705 ? ? 164.82 -33.24 18 1 MET A 709 ? ? 65.98 71.68 19 1 GLN A 711 ? ? -46.99 -71.89 20 1 ARG A 714 ? ? 47.75 81.61 21 1 LEU P 602 ? ? -164.93 119.06 22 1 GLN P 604 ? ? -64.95 78.62 23 2 PRO A 582 ? ? -44.77 104.24 24 2 GLN A 589 ? ? -110.37 57.71 25 2 LYS A 634 ? ? 65.30 124.21 26 2 SER A 635 ? ? -144.74 42.62 27 2 TYR A 637 ? ? 75.84 -68.47 28 2 PRO A 640 ? ? -73.08 -164.56 29 2 GLN A 642 ? ? 84.84 -70.73 30 2 LEU A 644 ? ? -129.82 -157.57 31 2 VAL A 656 ? ? 50.70 142.22 32 2 ASN A 660 ? ? 63.10 -73.59 33 2 ASN A 661 ? ? -144.91 -0.74 34 2 GLN A 666 ? ? -45.19 98.52 35 2 ASP A 674 ? ? -39.80 118.81 36 2 ASN A 704 ? ? -138.24 -42.59 37 2 GLU A 705 ? ? 137.29 -37.61 38 2 LEU A 710 ? ? 79.11 -177.80 39 2 GLN A 711 ? ? -69.01 66.21 40 2 ARG A 714 ? ? -90.95 -145.10 41 2 GLU P 601 ? ? -170.40 100.62 42 2 LEU P 602 ? ? -177.07 105.21 43 2 GLU P 605 ? ? 59.64 108.18 44 3 PHE A 577 ? ? -122.02 -64.98 45 3 PRO A 582 ? ? -48.25 103.14 46 3 ALA A 631 ? ? -179.73 148.81 47 3 LYS A 634 ? ? 59.90 177.41 48 3 MET A 636 ? ? -143.29 29.96 49 3 TYR A 637 ? ? -178.39 -47.24 50 3 PRO A 640 ? ? -71.49 -159.23 51 3 GLN A 642 ? ? 83.36 -66.53 52 3 LEU A 644 ? ? -118.85 -158.50 53 3 VAL A 656 ? ? 52.82 126.80 54 3 ASN A 660 ? ? 60.70 -82.50 55 3 GLN A 666 ? ? -52.21 98.09 56 3 GLU A 705 ? ? 88.67 -45.06 57 3 LEU A 710 ? ? -31.97 133.38 58 3 LYS A 729 ? ? -97.81 30.22 59 3 GLU P 601 ? ? -144.86 31.03 60 4 PRO A 582 ? ? -45.34 105.29 61 4 GLN A 589 ? ? -112.32 58.22 62 4 LYS A 634 ? ? 43.13 92.87 63 4 TYR A 637 ? ? 69.35 -65.10 64 4 GLN A 642 ? ? 58.78 -168.13 65 4 LEU A 644 ? ? -105.18 -153.35 66 4 VAL A 656 ? ? 74.80 145.36 67 4 ASN A 660 ? ? 67.75 -83.29 68 4 ASN A 704 ? ? -153.60 -49.36 69 4 GLU A 705 ? ? 137.50 -36.37 70 4 ARG A 714 ? ? 39.57 86.78 71 5 PHE A 577 ? ? -121.46 -52.98 72 5 PRO A 582 ? ? -44.90 102.47 73 5 GLN A 589 ? ? -106.04 66.00 74 5 ASN A 616 ? ? -40.00 -29.40 75 5 LYS A 634 ? ? 63.24 140.99 76 5 TYR A 637 ? ? 67.25 -74.43 77 5 PRO A 640 ? ? -58.84 -154.38 78 5 GLN A 642 ? ? 71.97 -65.04 79 5 LEU A 644 ? ? -121.87 -155.34 80 5 VAL A 656 ? ? 53.65 125.21 81 5 ASN A 660 ? ? 61.40 -81.07 82 5 GLN A 666 ? ? -44.31 96.84 83 5 LYS A 687 ? ? 59.99 19.52 84 5 THR A 700 ? ? -65.81 61.75 85 5 PHE A 703 ? ? -60.60 -143.24 86 5 ASN A 704 ? ? -56.49 2.57 87 5 GLU A 705 ? ? 82.91 -54.63 88 5 LEU A 710 ? ? 178.91 166.09 89 5 ARG A 714 ? ? 37.42 88.16 90 5 LYS A 729 ? ? -99.40 30.83 91 5 VAL P 600 ? ? -117.31 77.72 92 5 GLU P 601 ? ? -175.82 37.92 93 5 GLU P 605 ? ? 62.12 150.12 94 6 PRO A 582 ? ? -44.60 99.58 95 6 GLN A 589 ? ? -109.08 57.44 96 6 GLN A 596 ? ? -7.53 -62.23 97 6 ASN A 616 ? ? -39.28 -30.26 98 6 ALA A 631 ? ? 179.92 114.20 99 6 LYS A 634 ? ? -169.29 115.00 100 6 TYR A 637 ? ? 61.73 -84.79 101 6 PRO A 640 ? ? -67.86 -162.15 102 6 ALA A 641 ? ? 78.76 -56.55 103 6 GLN A 642 ? ? 69.30 -69.19 104 6 LEU A 644 ? ? -115.15 -165.80 105 6 VAL A 656 ? ? 51.80 128.56 106 6 ASN A 660 ? ? 61.57 -81.07 107 6 GLN A 666 ? ? -45.62 107.07 108 6 ASP A 674 ? ? -42.93 104.00 109 6 GLU A 705 ? ? 140.63 -17.81 110 6 MET A 709 ? ? -173.57 110.42 111 6 GLN A 711 ? ? 49.63 27.95 112 6 ARG A 714 ? ? -96.13 -150.65 113 6 GLU P 601 ? ? -105.30 64.75 114 6 GLU P 605 ? ? 53.75 106.78 115 7 PRO A 582 ? ? -46.67 108.92 116 7 GLN A 589 ? ? -114.38 63.67 117 7 GLN A 595 ? ? -51.17 105.16 118 7 GLN A 596 ? ? 41.63 -125.76 119 7 ASN A 616 ? ? -38.73 -30.86 120 7 TYR A 637 ? ? 68.60 -68.00 121 7 ALA A 641 ? ? 70.35 -64.49 122 7 GLN A 642 ? ? 67.47 -68.99 123 7 LEU A 644 ? ? -115.28 -154.53 124 7 VAL A 656 ? ? 53.60 126.12 125 7 ASN A 660 ? ? 61.94 -81.91 126 7 GLN A 666 ? ? -48.05 100.16 127 7 LYS A 687 ? ? 58.11 19.23 128 7 THR A 700 ? ? -67.69 62.06 129 7 PHE A 703 ? ? -58.24 -141.80 130 7 ASN A 704 ? ? -59.24 9.05 131 7 GLU A 705 ? ? 77.95 -56.89 132 7 MET A 709 ? ? -39.98 135.64 133 7 LEU A 710 ? ? 73.71 -172.76 134 7 GLN A 711 ? ? -58.80 -97.49 135 7 ARG A 714 ? ? -160.55 76.06 136 7 VAL P 600 ? ? -146.26 58.42 137 7 GLU P 605 ? ? -59.86 107.79 138 8 PRO A 582 ? ? -46.03 100.07 139 8 GLN A 589 ? ? -117.32 60.12 140 8 ASN A 616 ? ? -39.86 -27.51 141 8 LYS A 634 ? ? -171.12 98.45 142 8 TYR A 637 ? ? 71.38 -65.42 143 8 GLN A 642 ? ? 74.72 -68.90 144 8 LEU A 644 ? ? -103.70 -153.15 145 8 VAL A 656 ? ? 51.38 134.90 146 8 ASN A 660 ? ? 58.68 -82.26 147 8 GLN A 666 ? ? -48.90 94.01 148 8 ASP A 674 ? ? -59.19 100.00 149 8 THR A 700 ? ? -69.01 69.20 150 8 ASN A 704 ? ? -164.73 -54.13 151 8 GLU A 705 ? ? 160.99 -31.03 152 8 MET A 709 ? ? -178.32 121.27 153 8 LEU A 710 ? ? -39.92 162.07 154 8 GLN A 711 ? ? 75.24 -62.85 155 8 ARG A 714 ? ? 38.91 88.27 156 9 PRO A 582 ? ? -46.27 99.76 157 9 GLN A 589 ? ? -116.09 54.88 158 9 ALA A 631 ? ? 170.97 123.69 159 9 LYS A 634 ? ? 60.02 159.59 160 9 SER A 635 ? ? -109.59 58.36 161 9 TYR A 637 ? ? 69.40 -66.94 162 9 PRO A 640 ? ? -70.49 -153.68 163 9 ALA A 641 ? ? -97.33 34.00 164 9 GLN A 642 ? ? 66.89 -72.55 165 9 LEU A 644 ? ? -118.16 -147.64 166 9 VAL A 656 ? ? 51.17 133.38 167 9 ASN A 660 ? ? 55.43 -82.74 168 9 GLN A 666 ? ? -44.59 98.92 169 9 ASP A 674 ? ? -36.01 107.32 170 9 PHE A 703 ? ? -55.92 -149.91 171 9 ASN A 704 ? ? -31.52 -34.42 172 9 GLU A 705 ? ? 105.04 6.14 173 9 MET A 709 ? ? 46.80 86.62 174 9 GLN A 711 ? ? 59.16 75.50 175 9 ARG A 714 ? ? -100.31 -157.54 176 9 GLU P 601 ? ? 60.17 70.99 177 9 GLU P 605 ? ? 64.33 156.41 178 10 PRO A 582 ? ? -46.03 98.99 179 10 GLN A 589 ? ? -112.64 55.98 180 10 SER A 619 ? ? -48.13 167.39 181 10 TYR A 637 ? ? 69.71 -65.98 182 10 PRO A 640 ? ? -76.19 -165.11 183 10 GLN A 642 ? ? 62.55 -80.10 184 10 LEU A 644 ? ? -104.15 -152.92 185 10 VAL A 656 ? ? 56.77 133.00 186 10 ASN A 660 ? ? 60.90 -81.94 187 10 GLN A 666 ? ? -47.91 95.69 188 10 ASP A 674 ? ? -48.07 96.74 189 10 THR A 700 ? ? -69.67 72.39 190 10 PHE A 703 ? ? -61.20 -142.63 191 10 ASN A 704 ? ? -35.81 -36.63 192 10 GLU A 705 ? ? 125.42 -22.52 193 10 LEU A 710 ? ? -60.23 -154.47 194 10 ARG A 714 ? ? 35.26 77.96 195 10 LEU P 602 ? ? 62.83 138.97 196 11 PRO A 582 ? ? -47.26 99.22 197 11 GLN A 589 ? ? -108.41 56.79 198 11 TYR A 637 ? ? -176.74 -43.62 199 11 ALA A 641 ? ? -96.48 34.66 200 11 GLN A 642 ? ? 59.64 -174.03 201 11 LEU A 644 ? ? -119.89 -149.01 202 11 VAL A 656 ? ? 54.83 123.05 203 11 ASN A 660 ? ? 61.20 -81.34 204 11 GLN A 666 ? ? -51.87 100.14 205 11 LYS A 687 ? ? 59.66 17.95 206 11 THR A 700 ? ? -66.62 65.30 207 11 ASN A 704 ? ? 49.70 -74.40 208 11 GLU A 705 ? ? 161.82 -36.59 209 11 MET A 709 ? ? 60.31 109.78 210 11 GLN A 711 ? ? 178.10 -57.40 211 11 ARG A 714 ? ? 17.94 84.11 212 11 GLN P 604 ? ? -63.01 88.09 213 12 PRO A 582 ? ? -47.84 105.30 214 12 GLN A 589 ? ? -112.87 63.70 215 12 ASN A 616 ? ? -39.44 -27.74 216 12 ALA A 631 ? ? -73.15 -163.55 217 12 TYR A 637 ? ? 70.97 -63.63 218 12 PRO A 640 ? ? -65.54 -155.80 219 12 GLN A 642 ? ? 70.11 -67.73 220 12 VAL A 656 ? ? 49.12 136.33 221 12 ASN A 660 ? ? 61.83 -80.14 222 12 ASP A 674 ? ? -42.38 107.15 223 12 PHE A 703 ? ? -60.28 -142.57 224 12 ASN A 704 ? ? -29.89 -37.37 225 12 GLU A 705 ? ? 117.55 -37.07 226 12 LEU A 710 ? ? -88.63 44.84 227 12 GLN A 711 ? ? -105.01 -75.87 228 12 ARG A 714 ? ? -10.63 78.65 229 12 GLU P 601 ? ? -165.42 52.75 230 13 PHE A 577 ? ? -124.01 -63.25 231 13 PRO A 582 ? ? -47.28 99.12 232 13 GLN A 589 ? ? -107.68 58.13 233 13 TYR A 637 ? ? 67.81 -72.24 234 13 PRO A 640 ? ? -59.36 -150.56 235 13 GLN A 642 ? ? 77.37 -74.76 236 13 LEU A 644 ? ? -134.20 -156.59 237 13 VAL A 656 ? ? 51.31 130.01 238 13 ASN A 660 ? ? 60.26 -81.78 239 13 GLN A 666 ? ? -54.86 100.90 240 13 LYS A 687 ? ? 59.82 19.20 241 13 ASN A 704 ? ? -141.13 -42.24 242 13 GLU A 705 ? ? 135.17 -29.59 243 13 MET A 709 ? ? 68.79 117.47 244 13 LEU A 710 ? ? -28.64 144.82 245 14 PHE A 577 ? ? -126.90 -62.86 246 14 PRO A 582 ? ? -45.43 104.68 247 14 GLN A 589 ? ? -109.70 60.81 248 14 LYS A 634 ? ? 63.30 142.52 249 14 TYR A 637 ? ? 68.34 -68.00 250 14 PRO A 640 ? ? -66.49 -150.60 251 14 GLN A 642 ? ? 81.23 -72.12 252 14 LEU A 644 ? ? -122.70 -155.30 253 14 VAL A 656 ? ? 50.72 133.69 254 14 ASN A 660 ? ? 59.78 -79.42 255 14 GLN A 666 ? ? -38.49 98.14 256 14 ASP A 674 ? ? -38.88 116.95 257 14 ASN A 704 ? ? -140.42 -47.22 258 14 GLU A 705 ? ? 136.28 -35.55 259 14 LEU A 710 ? ? 64.70 -166.42 260 14 GLN A 711 ? ? -58.85 -106.42 261 14 ARG A 714 ? ? 167.39 130.37 262 14 VAL P 600 ? ? -112.14 73.96 263 14 GLU P 605 ? ? 59.92 90.29 264 15 PHE A 577 ? ? -121.69 -62.41 265 15 PRO A 582 ? ? -46.14 101.57 266 15 GLN A 589 ? ? -105.35 57.58 267 15 VAL A 621 ? ? -140.27 56.58 268 15 ALA A 631 ? ? -164.22 98.37 269 15 LYS A 634 ? ? 59.48 -177.58 270 15 TYR A 637 ? ? 69.87 -65.46 271 15 PRO A 640 ? ? -69.81 -150.70 272 15 ALA A 641 ? ? -93.61 32.51 273 15 GLN A 642 ? ? 60.29 -83.81 274 15 LEU A 644 ? ? -120.03 -153.23 275 15 VAL A 656 ? ? 53.27 133.29 276 15 ASN A 660 ? ? 60.56 -81.75 277 15 GLN A 666 ? ? -47.25 96.55 278 15 ASN A 704 ? ? -148.37 -53.40 279 15 GLU A 705 ? ? 144.23 -50.26 280 15 MET A 709 ? ? 60.39 -143.26 281 15 LEU A 710 ? ? -56.92 -161.04 282 15 GLN A 711 ? ? -41.16 -86.13 283 15 ARG A 714 ? ? -154.94 77.27 284 16 PHE A 577 ? ? -122.30 -52.79 285 16 PRO A 582 ? ? -45.98 104.42 286 16 GLN A 589 ? ? -107.65 59.33 287 16 ASN A 616 ? ? -39.34 -29.75 288 16 VAL A 621 ? ? -109.22 57.43 289 16 ALA A 631 ? ? -165.42 103.63 290 16 TYR A 637 ? ? 69.81 -64.11 291 16 PRO A 640 ? ? -70.30 -161.06 292 16 GLN A 642 ? ? 63.27 -78.51 293 16 LEU A 644 ? ? -93.08 -157.36 294 16 VAL A 656 ? ? 79.06 143.04 295 16 ASN A 660 ? ? 56.12 -82.72 296 16 GLN A 666 ? ? -45.62 100.36 297 16 ASP A 674 ? ? -44.50 103.06 298 16 GLU A 705 ? ? 146.60 -19.88 299 16 LEU A 710 ? ? -64.75 -166.56 300 16 GLN A 711 ? ? 69.79 -65.64 301 16 ARG A 714 ? ? 32.20 94.80 302 16 LEU P 602 ? ? -172.22 135.34 303 16 GLU P 605 ? ? 59.87 155.16 304 17 PHE A 577 ? ? -127.94 -52.65 305 17 PRO A 582 ? ? -45.01 100.52 306 17 GLN A 589 ? ? -108.75 60.27 307 17 ASN A 616 ? ? -39.25 -28.05 308 17 VAL A 621 ? ? -108.55 60.22 309 17 LYS A 634 ? ? -148.50 40.48 310 17 SER A 635 ? ? 49.63 86.28 311 17 TYR A 637 ? ? 68.39 -69.07 312 17 PRO A 640 ? ? -64.98 -149.21 313 17 ALA A 641 ? ? -92.29 38.27 314 17 GLN A 642 ? ? 54.89 -167.98 315 17 LEU A 644 ? ? -105.50 -155.73 316 17 VAL A 656 ? ? 54.08 122.79 317 17 ASN A 660 ? ? 59.90 -81.92 318 17 GLN A 666 ? ? -54.72 90.83 319 17 ASP A 674 ? ? -47.66 106.69 320 17 LYS A 687 ? ? 59.26 19.11 321 17 ASN A 704 ? ? -158.08 -57.80 322 17 GLU A 705 ? ? 164.40 -30.17 323 17 LEU A 710 ? ? -100.43 -164.20 324 17 GLN A 711 ? ? -51.72 -71.29 325 17 ARG A 714 ? ? 46.93 87.27 326 18 PRO A 582 ? ? -47.15 97.97 327 18 GLN A 589 ? ? -104.95 62.30 328 18 ASN A 616 ? ? -39.81 -29.41 329 18 ALA A 631 ? ? -160.10 117.53 330 18 TYR A 637 ? ? 177.75 -99.46 331 18 PRO A 640 ? ? -54.98 -168.98 332 18 ALA A 641 ? ? 69.96 -63.77 333 18 GLN A 642 ? ? 66.17 -175.68 334 18 LEU A 644 ? ? -100.69 -160.23 335 18 VAL A 656 ? ? 60.34 135.13 336 18 ASN A 660 ? ? 56.39 -85.14 337 18 GLN A 666 ? ? -47.07 99.39 338 18 ASN A 704 ? ? -146.57 -63.27 339 18 GLU A 705 ? ? 145.52 32.69 340 18 ARG A 714 ? ? 41.06 86.48 341 18 GLU P 601 ? ? -122.45 -165.35 342 18 LEU P 602 ? ? 64.55 116.28 343 19 PRO A 582 ? ? -46.00 102.65 344 19 GLN A 589 ? ? -107.69 71.25 345 19 VAL A 621 ? ? -119.74 61.28 346 19 ALA A 631 ? ? -70.12 -162.32 347 19 LYS A 634 ? ? 59.65 175.19 348 19 SER A 635 ? ? -163.97 36.86 349 19 TYR A 637 ? ? 71.94 -62.55 350 19 PRO A 640 ? ? -62.14 -154.32 351 19 GLN A 642 ? ? 78.44 -66.51 352 19 LEU A 644 ? ? -108.80 -154.23 353 19 VAL A 656 ? ? 54.74 124.73 354 19 ASN A 660 ? ? 61.92 -78.92 355 19 GLN A 666 ? ? -48.20 104.16 356 19 LYS A 687 ? ? 59.74 18.43 357 19 PHE A 703 ? ? -37.32 -33.65 358 19 ASN A 704 ? ? -141.29 -43.14 359 19 GLU A 705 ? ? 137.89 -32.42 360 19 MET A 709 ? ? 172.57 90.58 361 19 LEU A 710 ? ? 36.92 97.06 362 19 GLN A 711 ? ? 77.08 121.16 363 19 GLU A 712 ? ? -62.54 98.89 364 19 ARG A 714 ? ? -176.48 125.29 365 19 GLU P 605 ? ? 60.86 96.12 366 20 PHE A 577 ? ? -126.98 -54.38 367 20 PRO A 582 ? ? -45.61 100.65 368 20 GLN A 589 ? ? -109.63 57.04 369 20 VAL A 621 ? ? -119.80 70.82 370 20 LYS A 634 ? ? -176.25 81.37 371 20 SER A 635 ? ? -119.66 52.35 372 20 TYR A 637 ? ? 70.40 -62.88 373 20 PRO A 640 ? ? -62.16 -148.34 374 20 GLN A 642 ? ? 69.06 -77.89 375 20 LEU A 644 ? ? -115.45 -155.26 376 20 VAL A 656 ? ? 53.07 125.80 377 20 ASN A 660 ? ? 59.50 -83.28 378 20 GLN A 666 ? ? -52.77 91.50 379 20 ASP A 674 ? ? -50.12 105.87 380 20 THR A 700 ? ? -66.08 64.13 381 20 ASN A 704 ? ? 55.12 -76.01 382 20 GLU A 705 ? ? 179.82 -30.00 383 20 MET A 709 ? ? 60.16 91.06 384 20 LEU A 710 ? ? -171.32 -167.17 385 20 ARG A 714 ? ? 53.39 76.85 386 20 VAL P 600 ? ? -94.30 47.18 387 20 GLN P 604 ? ? -69.44 88.20 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 5 _pdbx_struct_mod_residue.auth_asym_id P _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 603 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_nmr_ensemble.entry_id 1K2N _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5 mM FHA2 U-15N,13C; 1.5 mM phosphothreonyl peptide of Rad9; 10 mM sodium phosphate(pH 6.5), 1 mM DTT, and 1 mM EDTA' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM sodium phosphate, 1 mM DTT, and 1 mM EDTA' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY 3 1 1 2D_13C/15N-filtered_NOESY 4 1 1 3D_13C-edited_13C/15N-filtered_NOESY # _pdbx_nmr_details.entry_id 1K2N _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1K2N _pdbx_nmr_refine.method ;The complex structures are generated using a total of 3369 restraints, 3181 distance restraints, and 188 TALOS-derived dihedral angle restraints. ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 XwinNMR 2.6 processing Bruker 2 X-PLOR 3.851 'structure solution' Brunger 3 X-PLOR 3.851 refinement Brunger 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TPO N N N N 318 TPO CA C N S 319 TPO CB C N R 320 TPO CG2 C N N 321 TPO OG1 O N N 322 TPO P P N N 323 TPO O1P O N N 324 TPO O2P O N N 325 TPO O3P O N N 326 TPO C C N N 327 TPO O O N N 328 TPO OXT O N N 329 TPO H H N N 330 TPO H2 H N N 331 TPO HA H N N 332 TPO HB H N N 333 TPO HG21 H N N 334 TPO HG22 H N N 335 TPO HG23 H N N 336 TPO HOP2 H N N 337 TPO HOP3 H N N 338 TPO HXT H N N 339 TRP N N N N 340 TRP CA C N S 341 TRP C C N N 342 TRP O O N N 343 TRP CB C N N 344 TRP CG C Y N 345 TRP CD1 C Y N 346 TRP CD2 C Y N 347 TRP NE1 N Y N 348 TRP CE2 C Y N 349 TRP CE3 C Y N 350 TRP CZ2 C Y N 351 TRP CZ3 C Y N 352 TRP CH2 C Y N 353 TRP OXT O N N 354 TRP H H N N 355 TRP H2 H N N 356 TRP HA H N N 357 TRP HB2 H N N 358 TRP HB3 H N N 359 TRP HD1 H N N 360 TRP HE1 H N N 361 TRP HE3 H N N 362 TRP HZ2 H N N 363 TRP HZ3 H N N 364 TRP HH2 H N N 365 TRP HXT H N N 366 TYR N N N N 367 TYR CA C N S 368 TYR C C N N 369 TYR O O N N 370 TYR CB C N N 371 TYR CG C Y N 372 TYR CD1 C Y N 373 TYR CD2 C Y N 374 TYR CE1 C Y N 375 TYR CE2 C Y N 376 TYR CZ C Y N 377 TYR OH O N N 378 TYR OXT O N N 379 TYR H H N N 380 TYR H2 H N N 381 TYR HA H N N 382 TYR HB2 H N N 383 TYR HB3 H N N 384 TYR HD1 H N N 385 TYR HD2 H N N 386 TYR HE1 H N N 387 TYR HE2 H N N 388 TYR HH H N N 389 TYR HXT H N N 390 VAL N N N N 391 VAL CA C N S 392 VAL C C N N 393 VAL O O N N 394 VAL CB C N N 395 VAL CG1 C N N 396 VAL CG2 C N N 397 VAL OXT O N N 398 VAL H H N N 399 VAL H2 H N N 400 VAL HA H N N 401 VAL HB H N N 402 VAL HG11 H N N 403 VAL HG12 H N N 404 VAL HG13 H N N 405 VAL HG21 H N N 406 VAL HG22 H N N 407 VAL HG23 H N N 408 VAL HXT H N N 409 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TPO N CA sing N N 304 TPO N H sing N N 305 TPO N H2 sing N N 306 TPO CA CB sing N N 307 TPO CA C sing N N 308 TPO CA HA sing N N 309 TPO CB CG2 sing N N 310 TPO CB OG1 sing N N 311 TPO CB HB sing N N 312 TPO CG2 HG21 sing N N 313 TPO CG2 HG22 sing N N 314 TPO CG2 HG23 sing N N 315 TPO OG1 P sing N N 316 TPO P O1P doub N N 317 TPO P O2P sing N N 318 TPO P O3P sing N N 319 TPO O2P HOP2 sing N N 320 TPO O3P HOP3 sing N N 321 TPO C O doub N N 322 TPO C OXT sing N N 323 TPO OXT HXT sing N N 324 TRP N CA sing N N 325 TRP N H sing N N 326 TRP N H2 sing N N 327 TRP CA C sing N N 328 TRP CA CB sing N N 329 TRP CA HA sing N N 330 TRP C O doub N N 331 TRP C OXT sing N N 332 TRP CB CG sing N N 333 TRP CB HB2 sing N N 334 TRP CB HB3 sing N N 335 TRP CG CD1 doub Y N 336 TRP CG CD2 sing Y N 337 TRP CD1 NE1 sing Y N 338 TRP CD1 HD1 sing N N 339 TRP CD2 CE2 doub Y N 340 TRP CD2 CE3 sing Y N 341 TRP NE1 CE2 sing Y N 342 TRP NE1 HE1 sing N N 343 TRP CE2 CZ2 sing Y N 344 TRP CE3 CZ3 doub Y N 345 TRP CE3 HE3 sing N N 346 TRP CZ2 CH2 doub Y N 347 TRP CZ2 HZ2 sing N N 348 TRP CZ3 CH2 sing Y N 349 TRP CZ3 HZ3 sing N N 350 TRP CH2 HH2 sing N N 351 TRP OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.field_strength 800 # _atom_sites.entry_id 1K2N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_