data_1K8O # _entry.id 1K8O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K8O pdb_00001k8o 10.2210/pdb1k8o/pdb RCSB RCSB014698 ? ? WWPDB D_1000014698 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2016-05-25 5 'Structure model' 1 4 2022-12-21 6 'Structure model' 1 5 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Source and taxonomy' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_nmr_software 3 5 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' struct_ref_seq_dif 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K8O _pdbx_database_status.recvd_initial_deposition_date 2001-10-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1K8M '1K8M contains the average structure of the same protein' unspecified BMRB 5078 '5078 CONTAINS CHEMICAL SHIFT LISTS EXCLUDING FIRST MET' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chang, C.-F.' 1 'Chou, H.-T.' 2 'Chuang, J.L.' 3 'Chuang, D.T.' 4 'Huang, T.-h.' 5 # _citation.id primary _citation.title ;Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 15865 _citation.page_last 15873 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11839747 _citation.pdbx_database_id_DOI 10.1074/jbc.M110952200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, C.-F.' 1 ? primary 'Chou, H.-T.' 2 ? primary 'Chuang, J.L.' 3 ? primary 'Chuang, D.T.' 4 ? primary 'Huang, T.-h.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase' _entity.formula_weight 10662.938 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.3.1.- _entity.pdbx_mutation ? _entity.pdbx_fragment 'LIPOIC ACID-BEARING DOMAIN' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DIHYDROLIPOAMIDE BRANCHED CHAIN TRANSACYLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIET EALKDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIET EALKDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLN n 1 4 VAL n 1 5 VAL n 1 6 GLN n 1 7 PHE n 1 8 LYS n 1 9 LEU n 1 10 SER n 1 11 ASP n 1 12 ILE n 1 13 GLY n 1 14 GLU n 1 15 GLY n 1 16 ILE n 1 17 ARG n 1 18 GLU n 1 19 VAL n 1 20 THR n 1 21 VAL n 1 22 LYS n 1 23 GLU n 1 24 TRP n 1 25 TYR n 1 26 VAL n 1 27 LYS n 1 28 GLU n 1 29 GLY n 1 30 ASP n 1 31 THR n 1 32 VAL n 1 33 SER n 1 34 GLN n 1 35 PHE n 1 36 ASP n 1 37 SER n 1 38 ILE n 1 39 CYS n 1 40 GLU n 1 41 VAL n 1 42 GLN n 1 43 SER n 1 44 ASP n 1 45 LYS n 1 46 ALA n 1 47 SER n 1 48 VAL n 1 49 THR n 1 50 ILE n 1 51 THR n 1 52 SER n 1 53 ARG n 1 54 TYR n 1 55 ASP n 1 56 GLY n 1 57 VAL n 1 58 ILE n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 TYR n 1 63 TYR n 1 64 ASN n 1 65 LEU n 1 66 ASP n 1 67 ASP n 1 68 ILE n 1 69 ALA n 1 70 TYR n 1 71 VAL n 1 72 GLY n 1 73 LYS n 1 74 PRO n 1 75 LEU n 1 76 VAL n 1 77 ASP n 1 78 ILE n 1 79 GLU n 1 80 THR n 1 81 GLU n 1 82 ALA n 1 83 LEU n 1 84 LYS n 1 85 ASP n 1 86 LEU n 1 87 GLU n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n 1 93 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n A 1 93 HIS 93 93 ? ? ? A . n # _exptl.entry_id 1K8O _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _database_PDB_matrix.entry_id 1K8O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K8O _struct.title ;Solution Structure of the Lipoic Acid-Bearing Domain of the E2 component of Human, Mitochondrial Branched-Chain alpha-Ketoacid Dehydrogenase ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K8O _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'Lipoyl Acid Bearing, Human BCKD, Experimental NMR data, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ODB2_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETE ALKD ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_accession P11182 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1K8O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P11182 _struct_ref_seq.db_align_beg 62 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1K8O MET A 1 ? UNP P11182 ? ? 'initiating methionine' 1 1 1 1K8O LEU A 86 ? UNP P11182 ? ? 'expression tag' 86 2 1 1K8O GLU A 87 ? UNP P11182 ? ? 'expression tag' 87 3 1 1K8O HIS A 88 ? UNP P11182 ? ? 'expression tag' 88 4 1 1K8O HIS A 89 ? UNP P11182 ? ? 'expression tag' 89 5 1 1K8O HIS A 90 ? UNP P11182 ? ? 'expression tag' 90 6 1 1K8O HIS A 91 ? UNP P11182 ? ? 'expression tag' 91 7 1 1K8O HIS A 92 ? UNP P11182 ? ? 'expression tag' 92 8 1 1K8O HIS A 93 ? UNP P11182 ? ? 'expression tag' 93 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 5 ? LYS A 8 ? VAL A 5 LYS A 8 A 2 PRO A 74 ? GLU A 79 ? PRO A 74 GLU A 79 A 3 VAL A 57 ? LYS A 60 ? VAL A 57 LYS A 60 B 1 SER A 47 ? THR A 49 ? SER A 47 THR A 49 B 2 CYS A 39 ? GLN A 42 ? CYS A 39 GLN A 42 B 3 VAL A 19 ? TRP A 24 ? VAL A 19 TRP A 24 B 4 ILE A 68 ? ALA A 69 ? ILE A 68 ALA A 69 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 5 ? N VAL A 5 O ILE A 78 ? O ILE A 78 A 2 3 O GLU A 79 ? O GLU A 79 N VAL A 57 ? N VAL A 57 B 1 2 O VAL A 48 ? O VAL A 48 N VAL A 41 ? N VAL A 41 B 2 3 O GLU A 40 ? O GLU A 40 N GLU A 23 ? N GLU A 23 B 3 4 N VAL A 19 ? N VAL A 19 O ALA A 69 ? O ALA A 69 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A VAL 32 ? ? O A GLY 56 ? ? 1.55 2 2 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 3 2 O A VAL 19 ? ? H A ALA 69 ? ? 1.58 4 3 H A VAL 32 ? ? O A GLY 56 ? ? 1.57 5 4 H A VAL 32 ? ? O A GLY 56 ? ? 1.55 6 5 H A VAL 32 ? ? O A GLY 56 ? ? 1.57 7 6 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 8 7 H A VAL 32 ? ? O A GLY 56 ? ? 1.55 9 8 H A VAL 32 ? ? O A GLY 56 ? ? 1.59 10 9 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 11 10 H A VAL 32 ? ? O A GLY 56 ? ? 1.57 12 11 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 13 12 H A VAL 32 ? ? O A GLY 56 ? ? 1.60 14 13 H A VAL 32 ? ? O A GLY 56 ? ? 1.58 15 14 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 16 15 H A VAL 32 ? ? O A GLY 56 ? ? 1.57 17 16 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 18 18 H A VAL 32 ? ? O A GLY 56 ? ? 1.56 19 19 H A VAL 32 ? ? O A GLY 56 ? ? 1.60 20 20 H A VAL 32 ? ? O A GLY 56 ? ? 1.57 21 20 H A LYS 22 ? ? O A GLU 40 ? ? 1.58 22 20 O A VAL 5 ? ? H A ILE 78 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 45 ? ? -72.43 -71.03 2 2 LEU A 9 ? ? -37.36 145.27 3 2 SER A 10 ? ? -52.90 -85.96 4 2 GLU A 14 ? ? -40.65 98.41 5 2 ILE A 16 ? ? -129.07 -162.02 6 2 ILE A 38 ? ? -85.62 -72.74 7 2 ALA A 82 ? ? -38.77 111.06 8 3 ASP A 11 ? ? 171.99 -29.24 9 3 ILE A 12 ? ? -98.66 -95.74 10 3 ILE A 16 ? ? -71.52 -167.14 11 3 ILE A 38 ? ? -90.28 -83.07 12 3 SER A 52 ? ? -97.97 -60.53 13 4 ASP A 11 ? ? 86.93 -18.22 14 4 ILE A 38 ? ? -84.55 -73.67 15 4 ALA A 82 ? ? -39.06 113.14 16 5 ASP A 11 ? ? -169.29 -40.04 17 5 ILE A 38 ? ? -90.63 -78.04 18 5 ASN A 64 ? ? -104.87 -168.29 19 5 ALA A 82 ? ? -38.02 111.71 20 6 ASP A 11 ? ? -135.43 -40.23 21 6 ILE A 38 ? ? -85.87 -70.97 22 6 PRO A 74 ? ? -46.86 165.24 23 6 LEU A 75 ? ? -120.27 -50.04 24 6 ALA A 82 ? ? -38.24 115.20 25 7 ASP A 11 ? ? 178.10 -35.36 26 7 GLU A 14 ? ? -65.98 77.63 27 8 ASP A 11 ? ? 85.97 -16.76 28 8 GLU A 14 ? ? -56.32 85.12 29 8 ILE A 38 ? ? -76.84 -71.22 30 9 ASP A 11 ? ? 85.56 -16.79 31 9 GLU A 14 ? ? -59.39 82.70 32 9 ILE A 38 ? ? -89.64 -73.91 33 9 LYS A 45 ? ? -86.96 -72.80 34 9 ARG A 53 ? ? 46.96 15.54 35 10 ASP A 11 ? ? 176.92 -33.84 36 10 ARG A 17 ? ? 151.29 146.44 37 10 ILE A 38 ? ? -94.87 -83.66 38 10 SER A 52 ? ? -98.47 -63.85 39 10 ALA A 82 ? ? -39.88 114.58 40 11 ASP A 11 ? ? -177.31 -40.26 41 11 GLU A 14 ? ? -62.48 92.27 42 11 ILE A 16 ? ? -62.30 -172.85 43 11 ILE A 38 ? ? -82.95 -70.49 44 11 LYS A 45 ? ? -63.68 -74.01 45 12 ASP A 11 ? ? 87.11 -22.17 46 12 ILE A 38 ? ? -90.85 -80.90 47 12 PRO A 74 ? ? -46.37 152.01 48 13 ASP A 11 ? ? 87.86 -16.24 49 13 GLU A 14 ? ? -47.76 93.44 50 13 ILE A 16 ? ? -105.51 -158.05 51 13 ILE A 38 ? ? -87.16 -79.35 52 14 GLU A 14 ? ? -45.20 105.80 53 14 ILE A 16 ? ? -125.05 -161.64 54 14 ILE A 38 ? ? -91.20 -75.24 55 15 ASP A 11 ? ? 175.12 -35.12 56 15 ILE A 16 ? ? -65.09 -168.68 57 15 ILE A 38 ? ? -91.72 -83.04 58 15 SER A 52 ? ? -107.37 -60.42 59 16 ASP A 11 ? ? -159.11 -42.05 60 16 ILE A 38 ? ? -79.94 -75.73 61 17 ASP A 11 ? ? 87.69 -24.16 62 17 ARG A 17 ? ? 157.09 134.24 63 17 ILE A 38 ? ? -91.23 -82.42 64 17 SER A 52 ? ? -94.92 -64.31 65 17 ARG A 53 ? ? 77.19 -2.26 66 17 ALA A 82 ? ? -37.91 110.91 67 18 ASP A 11 ? ? -178.86 -38.87 68 18 ILE A 38 ? ? -85.46 -72.33 69 18 LYS A 84 ? ? -17.83 -48.72 70 18 LEU A 86 ? ? -141.13 -31.73 71 19 SER A 10 ? ? -141.50 15.35 72 19 ILE A 16 ? ? -133.96 -154.53 73 19 ILE A 38 ? ? -85.32 -73.56 74 19 SER A 52 ? ? -102.96 -72.14 75 19 ARG A 53 ? ? 82.79 -11.44 76 19 ALA A 82 ? ? -39.02 112.24 77 20 LYS A 84 ? ? -17.55 -47.22 78 20 LEU A 86 ? ? -141.25 -31.30 # _pdbx_nmr_ensemble.entry_id 1K8O _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structure with the lowest energy and acceptable covalent geometry' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '2mM protein U-15N; 50mM phosphate buffer, pH7.5, 100mM NaCl, 0.02% (w/v) NaN3' '90% H2O, 10% D2O or 100% D2O' 2 '2mM protein U-15N,13C; 50mM phosphate buffer, pH7.5, 100mM NaCl, 0.02% (w/v) NaN3' '90% H2O, 10% D2O or 100% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 310 ambient 7.5 '100mM NaCl' ? K 2 310 ambient 7.5 '100mM NaCl' ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 HNHA 3 2 2 3D_13C-separated_NOESY # _pdbx_nmr_details.entry_id 1K8O _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1K8O _pdbx_nmr_refine.method 'distance geometry simulated annealing molecular dynamics torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.0 collection Bruker 1 XwinNMR 2.0 processing Bruker 2 AURELIA 2.0.6 'data analysis' Bruker 3 ARIA 1.0 refinement 'Nilges et al.' 4 ARIA 1.0 'structure solution' 'Nilges et al.' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 88 ? A HIS 88 2 1 Y 1 A HIS 89 ? A HIS 89 3 1 Y 1 A HIS 90 ? A HIS 90 4 1 Y 1 A HIS 91 ? A HIS 91 5 1 Y 1 A HIS 92 ? A HIS 92 6 1 Y 1 A HIS 93 ? A HIS 93 7 2 Y 1 A HIS 88 ? A HIS 88 8 2 Y 1 A HIS 89 ? A HIS 89 9 2 Y 1 A HIS 90 ? A HIS 90 10 2 Y 1 A HIS 91 ? A HIS 91 11 2 Y 1 A HIS 92 ? A HIS 92 12 2 Y 1 A HIS 93 ? A HIS 93 13 3 Y 1 A HIS 88 ? A HIS 88 14 3 Y 1 A HIS 89 ? A HIS 89 15 3 Y 1 A HIS 90 ? A HIS 90 16 3 Y 1 A HIS 91 ? A HIS 91 17 3 Y 1 A HIS 92 ? A HIS 92 18 3 Y 1 A HIS 93 ? A HIS 93 19 4 Y 1 A HIS 88 ? A HIS 88 20 4 Y 1 A HIS 89 ? A HIS 89 21 4 Y 1 A HIS 90 ? A HIS 90 22 4 Y 1 A HIS 91 ? A HIS 91 23 4 Y 1 A HIS 92 ? A HIS 92 24 4 Y 1 A HIS 93 ? A HIS 93 25 5 Y 1 A HIS 88 ? A HIS 88 26 5 Y 1 A HIS 89 ? A HIS 89 27 5 Y 1 A HIS 90 ? A HIS 90 28 5 Y 1 A HIS 91 ? A HIS 91 29 5 Y 1 A HIS 92 ? A HIS 92 30 5 Y 1 A HIS 93 ? A HIS 93 31 6 Y 1 A HIS 88 ? A HIS 88 32 6 Y 1 A HIS 89 ? A HIS 89 33 6 Y 1 A HIS 90 ? A HIS 90 34 6 Y 1 A HIS 91 ? A HIS 91 35 6 Y 1 A HIS 92 ? A HIS 92 36 6 Y 1 A HIS 93 ? A HIS 93 37 7 Y 1 A HIS 88 ? A HIS 88 38 7 Y 1 A HIS 89 ? A HIS 89 39 7 Y 1 A HIS 90 ? A HIS 90 40 7 Y 1 A HIS 91 ? A HIS 91 41 7 Y 1 A HIS 92 ? A HIS 92 42 7 Y 1 A HIS 93 ? A HIS 93 43 8 Y 1 A HIS 88 ? A HIS 88 44 8 Y 1 A HIS 89 ? A HIS 89 45 8 Y 1 A HIS 90 ? A HIS 90 46 8 Y 1 A HIS 91 ? A HIS 91 47 8 Y 1 A HIS 92 ? A HIS 92 48 8 Y 1 A HIS 93 ? A HIS 93 49 9 Y 1 A HIS 88 ? A HIS 88 50 9 Y 1 A HIS 89 ? A HIS 89 51 9 Y 1 A HIS 90 ? A HIS 90 52 9 Y 1 A HIS 91 ? A HIS 91 53 9 Y 1 A HIS 92 ? A HIS 92 54 9 Y 1 A HIS 93 ? A HIS 93 55 10 Y 1 A HIS 88 ? A HIS 88 56 10 Y 1 A HIS 89 ? A HIS 89 57 10 Y 1 A HIS 90 ? A HIS 90 58 10 Y 1 A HIS 91 ? A HIS 91 59 10 Y 1 A HIS 92 ? A HIS 92 60 10 Y 1 A HIS 93 ? A HIS 93 61 11 Y 1 A HIS 88 ? A HIS 88 62 11 Y 1 A HIS 89 ? A HIS 89 63 11 Y 1 A HIS 90 ? A HIS 90 64 11 Y 1 A HIS 91 ? A HIS 91 65 11 Y 1 A HIS 92 ? A HIS 92 66 11 Y 1 A HIS 93 ? A HIS 93 67 12 Y 1 A HIS 88 ? A HIS 88 68 12 Y 1 A HIS 89 ? A HIS 89 69 12 Y 1 A HIS 90 ? A HIS 90 70 12 Y 1 A HIS 91 ? A HIS 91 71 12 Y 1 A HIS 92 ? A HIS 92 72 12 Y 1 A HIS 93 ? A HIS 93 73 13 Y 1 A HIS 88 ? A HIS 88 74 13 Y 1 A HIS 89 ? A HIS 89 75 13 Y 1 A HIS 90 ? A HIS 90 76 13 Y 1 A HIS 91 ? A HIS 91 77 13 Y 1 A HIS 92 ? A HIS 92 78 13 Y 1 A HIS 93 ? A HIS 93 79 14 Y 1 A HIS 88 ? A HIS 88 80 14 Y 1 A HIS 89 ? A HIS 89 81 14 Y 1 A HIS 90 ? A HIS 90 82 14 Y 1 A HIS 91 ? A HIS 91 83 14 Y 1 A HIS 92 ? A HIS 92 84 14 Y 1 A HIS 93 ? A HIS 93 85 15 Y 1 A HIS 88 ? A HIS 88 86 15 Y 1 A HIS 89 ? A HIS 89 87 15 Y 1 A HIS 90 ? A HIS 90 88 15 Y 1 A HIS 91 ? A HIS 91 89 15 Y 1 A HIS 92 ? A HIS 92 90 15 Y 1 A HIS 93 ? A HIS 93 91 16 Y 1 A HIS 88 ? A HIS 88 92 16 Y 1 A HIS 89 ? A HIS 89 93 16 Y 1 A HIS 90 ? A HIS 90 94 16 Y 1 A HIS 91 ? A HIS 91 95 16 Y 1 A HIS 92 ? A HIS 92 96 16 Y 1 A HIS 93 ? A HIS 93 97 17 Y 1 A HIS 88 ? A HIS 88 98 17 Y 1 A HIS 89 ? A HIS 89 99 17 Y 1 A HIS 90 ? A HIS 90 100 17 Y 1 A HIS 91 ? A HIS 91 101 17 Y 1 A HIS 92 ? A HIS 92 102 17 Y 1 A HIS 93 ? A HIS 93 103 18 Y 1 A HIS 88 ? A HIS 88 104 18 Y 1 A HIS 89 ? A HIS 89 105 18 Y 1 A HIS 90 ? A HIS 90 106 18 Y 1 A HIS 91 ? A HIS 91 107 18 Y 1 A HIS 92 ? A HIS 92 108 18 Y 1 A HIS 93 ? A HIS 93 109 19 Y 1 A HIS 88 ? A HIS 88 110 19 Y 1 A HIS 89 ? A HIS 89 111 19 Y 1 A HIS 90 ? A HIS 90 112 19 Y 1 A HIS 91 ? A HIS 91 113 19 Y 1 A HIS 92 ? A HIS 92 114 19 Y 1 A HIS 93 ? A HIS 93 115 20 Y 1 A HIS 88 ? A HIS 88 116 20 Y 1 A HIS 89 ? A HIS 89 117 20 Y 1 A HIS 90 ? A HIS 90 118 20 Y 1 A HIS 91 ? A HIS 91 119 20 Y 1 A HIS 92 ? A HIS 92 120 20 Y 1 A HIS 93 ? A HIS 93 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AMX 500 # _atom_sites.entry_id 1K8O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_