data_1K99 # _entry.id 1K99 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1K99 pdb_00001k99 10.2210/pdb1k99/pdb RCSB RCSB014719 ? ? WWPDB D_1000014719 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2001-11-14 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2022-12-21 6 'Structure model' 1 5 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' struct_ref_seq_dif 7 6 'Structure model' chem_comp_atom 8 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1K99 _pdbx_database_status.recvd_initial_deposition_date 2001-10-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Xu, Y.' 1 'Yang, W.' 2 'Wu, J.' 3 'Shi, Y.' 4 # _citation.id primary _citation.title 'Solution structure of the first HMG box domain in human upstream binding factor.' _citation.journal_abbrev Biochemistry _citation.journal_volume 41 _citation.page_first 5415 _citation.page_last 5420 _citation.year 2002 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11969401 _citation.pdbx_database_id_DOI 10.1021/bi015977a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xu, Y.' 1 ? primary 'Yang, W.' 2 ? primary 'Wu, J.' 3 ? primary 'Shi, Y.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Upstream binding factor 1' _entity.formula_weight 12399.603 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'HMG box 1' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nucleolar transcription factor 1, hUBF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFRE DHPDLIQNAKKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFRE DHPDLIQNAKKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 LYS n 1 4 LEU n 1 5 LYS n 1 6 LYS n 1 7 HIS n 1 8 PRO n 1 9 ASP n 1 10 PHE n 1 11 PRO n 1 12 LYS n 1 13 LYS n 1 14 PRO n 1 15 LEU n 1 16 THR n 1 17 PRO n 1 18 TYR n 1 19 PHE n 1 20 ARG n 1 21 PHE n 1 22 PHE n 1 23 MET n 1 24 GLU n 1 25 LYS n 1 26 ARG n 1 27 ALA n 1 28 LYS n 1 29 TYR n 1 30 ALA n 1 31 LYS n 1 32 LEU n 1 33 HIS n 1 34 PRO n 1 35 GLU n 1 36 MET n 1 37 SER n 1 38 ASN n 1 39 LEU n 1 40 ASP n 1 41 LEU n 1 42 THR n 1 43 LYS n 1 44 ILE n 1 45 LEU n 1 46 SER n 1 47 LYS n 1 48 LYS n 1 49 TYR n 1 50 LYS n 1 51 GLU n 1 52 LEU n 1 53 PRO n 1 54 GLU n 1 55 LYS n 1 56 LYS n 1 57 LYS n 1 58 MET n 1 59 LYS n 1 60 TYR n 1 61 ILE n 1 62 GLN n 1 63 ASP n 1 64 PHE n 1 65 GLN n 1 66 ARG n 1 67 GLU n 1 68 LYS n 1 69 GLN n 1 70 GLU n 1 71 PHE n 1 72 GLU n 1 73 ARG n 1 74 ASN n 1 75 LEU n 1 76 ALA n 1 77 ARG n 1 78 PHE n 1 79 ARG n 1 80 GLU n 1 81 ASP n 1 82 HIS n 1 83 PRO n 1 84 ASP n 1 85 LEU n 1 86 ILE n 1 87 GLN n 1 88 ASN n 1 89 ALA n 1 90 LYS n 1 91 LYS n 1 92 LEU n 1 93 GLU n 1 94 HIS n 1 95 HIS n 1 96 HIS n 1 97 HIS n 1 98 HIS n 1 99 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'hUBF(103-192)' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-22b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 MET 23 23 23 MET MET A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 ? ? ? A . n A 1 93 GLU 93 93 ? ? ? A . n A 1 94 HIS 94 94 ? ? ? A . n A 1 95 HIS 95 95 ? ? ? A . n A 1 96 HIS 96 96 ? ? ? A . n A 1 97 HIS 97 97 ? ? ? A . n A 1 98 HIS 98 98 ? ? ? A . n A 1 99 HIS 99 99 ? ? ? A . n # _exptl.entry_id 1K99 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1K99 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1K99 _struct.title 'Solution Structure of the first HMG box in human Upstream binding factor' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1K99 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'alpha-helix, L-shape, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBF1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFRED HPDLIQNAKK ; _struct_ref.pdbx_align_begin 103 _struct_ref.pdbx_db_accession P17480 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1K99 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17480 _struct_ref_seq.db_align_beg 103 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 192 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1K99 MET A 1 ? UNP P17480 ? ? 'initiating methionine' 1 1 1 1K99 LEU A 92 ? UNP P17480 ? ? 'expression tag' 92 2 1 1K99 GLU A 93 ? UNP P17480 ? ? 'expression tag' 93 3 1 1K99 HIS A 94 ? UNP P17480 ? ? 'expression tag' 94 4 1 1K99 HIS A 95 ? UNP P17480 ? ? 'expression tag' 95 5 1 1K99 HIS A 96 ? UNP P17480 ? ? 'expression tag' 96 6 1 1K99 HIS A 97 ? UNP P17480 ? ? 'expression tag' 97 7 1 1K99 HIS A 98 ? UNP P17480 ? ? 'expression tag' 98 8 1 1K99 HIS A 99 ? UNP P17480 ? ? 'expression tag' 99 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 16 ? LYS A 31 ? THR A 16 LYS A 31 1 ? 16 HELX_P HELX_P2 2 ASN A 38 ? LEU A 52 ? ASN A 38 LEU A 52 1 ? 15 HELX_P HELX_P3 3 LYS A 56 ? ALA A 76 ? LYS A 56 ALA A 76 1 ? 21 HELX_P HELX_P4 4 ARG A 77 ? ASP A 81 ? ARG A 77 ASP A 81 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 2 ? ? -170.07 141.15 2 1 LEU A 4 ? ? -172.33 139.48 3 1 LYS A 5 ? ? -122.39 -158.25 4 1 ASP A 9 ? ? 59.81 93.08 5 1 PHE A 10 ? ? 59.52 78.70 6 1 PRO A 14 ? ? -49.27 173.95 7 1 HIS A 33 ? ? -115.32 59.64 8 1 MET A 36 ? ? -126.52 -150.36 9 1 SER A 37 ? ? -139.05 -57.85 10 1 ASN A 38 ? ? 169.79 -24.13 11 1 PRO A 53 ? ? -73.49 24.47 12 1 GLU A 54 ? ? 58.93 8.50 13 1 ASP A 81 ? ? -54.90 92.08 14 1 PRO A 83 ? ? -59.70 109.65 15 1 ASP A 84 ? ? -151.78 87.82 16 1 ILE A 86 ? ? 28.66 94.19 17 1 ASN A 88 ? ? -177.09 87.07 18 1 ALA A 89 ? ? -107.51 51.93 19 2 LEU A 4 ? ? -176.70 -172.86 20 2 PRO A 8 ? ? -54.22 -170.38 21 2 PHE A 10 ? ? 60.66 110.27 22 2 LYS A 13 ? ? -178.22 -61.87 23 2 PRO A 14 ? ? -56.05 174.57 24 2 HIS A 33 ? ? -119.49 52.07 25 2 MET A 36 ? ? -127.20 -156.04 26 2 SER A 37 ? ? -127.02 -57.46 27 2 ASN A 38 ? ? 167.83 -24.54 28 2 PRO A 53 ? ? -70.56 25.28 29 2 GLU A 54 ? ? 59.42 7.95 30 2 HIS A 82 ? ? -179.07 -54.63 31 2 ASP A 84 ? ? -119.77 -79.51 32 2 LEU A 85 ? ? 66.76 141.13 33 2 ALA A 89 ? ? -87.15 48.47 34 2 LYS A 90 ? ? 60.48 -83.68 35 3 LEU A 4 ? ? 64.89 109.72 36 3 LYS A 6 ? ? 55.85 -171.06 37 3 HIS A 7 ? ? 57.04 172.86 38 3 PRO A 8 ? ? -66.51 64.45 39 3 ASP A 9 ? ? -159.09 -47.00 40 3 PRO A 11 ? ? -53.16 102.09 41 3 LYS A 13 ? ? -177.84 -60.47 42 3 PRO A 14 ? ? -51.42 173.52 43 3 HIS A 33 ? ? -114.46 61.09 44 3 PRO A 53 ? ? -72.26 22.28 45 3 GLU A 54 ? ? 56.66 12.05 46 3 GLU A 80 ? ? -51.24 -81.46 47 3 ASP A 81 ? ? 50.43 -168.49 48 3 ASP A 84 ? ? -168.52 34.69 49 3 GLN A 87 ? ? 171.62 149.36 50 3 ASN A 88 ? ? 76.20 -51.41 51 3 ALA A 89 ? ? 64.00 68.25 52 3 LYS A 90 ? ? -101.46 -73.02 53 4 LYS A 3 ? ? 43.18 90.36 54 4 LEU A 4 ? ? 62.05 84.55 55 4 LYS A 5 ? ? -76.14 -71.93 56 4 HIS A 7 ? ? -177.62 -62.15 57 4 ASP A 9 ? ? -114.53 -169.38 58 4 LYS A 12 ? ? -179.74 146.26 59 4 LYS A 13 ? ? 177.20 -59.67 60 4 PRO A 14 ? ? -52.68 175.19 61 4 HIS A 33 ? ? -114.53 69.47 62 4 PRO A 53 ? ? -77.61 22.18 63 4 GLU A 54 ? ? 57.88 11.82 64 4 ALA A 76 ? ? -48.98 -77.63 65 4 PHE A 78 ? ? -52.01 -73.92 66 4 ARG A 79 ? ? -100.09 -100.02 67 4 GLU A 80 ? ? -100.34 -74.88 68 4 ASP A 81 ? ? 66.54 93.07 69 4 HIS A 82 ? ? -177.14 -52.79 70 4 GLN A 87 ? ? -106.15 -166.44 71 4 ASN A 88 ? ? 64.61 100.35 72 5 LYS A 2 ? ? 61.00 153.07 73 5 LEU A 4 ? ? 176.71 87.65 74 5 LYS A 5 ? ? -151.41 36.94 75 5 LYS A 6 ? ? -172.03 117.05 76 5 PRO A 8 ? ? -88.00 47.33 77 5 ASP A 9 ? ? 83.28 -16.22 78 5 PHE A 10 ? ? -173.70 -58.57 79 5 PRO A 11 ? ? -51.30 -177.43 80 5 LYS A 12 ? ? -177.93 -171.91 81 5 PRO A 14 ? ? -74.83 -167.01 82 5 HIS A 33 ? ? -119.58 53.63 83 5 MET A 36 ? ? -113.85 -163.74 84 5 ASN A 38 ? ? 82.32 -23.66 85 5 PRO A 53 ? ? -70.35 29.54 86 5 ARG A 73 ? ? -58.12 -85.97 87 5 ASP A 81 ? ? -56.29 -76.41 88 5 LEU A 85 ? ? -163.19 39.74 89 6 LYS A 2 ? ? -91.54 50.57 90 6 LYS A 3 ? ? -179.00 128.02 91 6 LEU A 4 ? ? -177.17 102.07 92 6 LYS A 5 ? ? -135.83 -88.17 93 6 LYS A 6 ? ? 172.47 -171.71 94 6 PRO A 8 ? ? -37.05 -32.48 95 6 ASP A 9 ? ? -125.85 -164.86 96 6 LYS A 12 ? ? 176.42 120.32 97 6 LYS A 13 ? ? 62.95 121.29 98 6 HIS A 33 ? ? -116.25 57.52 99 6 PRO A 53 ? ? -71.03 31.23 100 6 GLU A 54 ? ? 66.27 -2.82 101 6 ARG A 73 ? ? -44.33 -74.01 102 6 HIS A 82 ? ? -176.17 84.06 103 6 LEU A 85 ? ? 59.42 104.09 104 6 ASN A 88 ? ? -78.07 -75.18 105 6 ALA A 89 ? ? -166.45 -169.15 106 7 LEU A 4 ? ? 66.02 -170.72 107 7 HIS A 7 ? ? -173.28 -56.77 108 7 PRO A 8 ? ? -93.72 -71.93 109 7 ASP A 9 ? ? -57.71 -71.26 110 7 PRO A 11 ? ? -56.57 -178.59 111 7 LYS A 12 ? ? -174.31 143.50 112 7 HIS A 33 ? ? -115.13 56.09 113 7 MET A 36 ? ? -127.41 -148.42 114 7 SER A 37 ? ? -144.38 -62.04 115 7 ASN A 38 ? ? 176.24 -24.63 116 7 PRO A 53 ? ? -66.98 23.88 117 7 GLU A 54 ? ? 56.76 11.86 118 7 ARG A 73 ? ? -70.15 -91.21 119 7 PHE A 78 ? ? -100.09 -72.78 120 7 GLU A 80 ? ? -47.30 -76.37 121 7 ASP A 81 ? ? 55.68 175.35 122 7 PRO A 83 ? ? -66.57 87.82 123 7 GLN A 87 ? ? -157.79 -75.07 124 7 ASN A 88 ? ? -157.67 -96.09 125 7 ALA A 89 ? ? -178.55 -169.56 126 8 LYS A 5 ? ? -92.91 -68.79 127 8 LYS A 6 ? ? 172.62 147.75 128 8 PHE A 10 ? ? -176.75 63.77 129 8 PRO A 11 ? ? -62.80 99.80 130 8 LYS A 13 ? ? -147.79 -68.01 131 8 PRO A 14 ? ? -58.22 172.20 132 8 PRO A 53 ? ? -71.98 22.56 133 8 GLU A 54 ? ? 56.89 12.36 134 8 ARG A 73 ? ? -79.25 -83.71 135 8 ARG A 79 ? ? -22.46 -69.09 136 8 GLU A 80 ? ? -100.05 -89.03 137 8 HIS A 82 ? ? 59.28 96.10 138 8 ASP A 84 ? ? -178.46 -39.70 139 8 LEU A 85 ? ? -121.49 -165.55 140 8 ILE A 86 ? ? 43.50 104.77 141 8 GLN A 87 ? ? 86.80 -34.82 142 9 LYS A 3 ? ? -176.90 121.45 143 9 LYS A 5 ? ? 63.33 124.24 144 9 LYS A 6 ? ? -106.99 74.91 145 9 PHE A 10 ? ? 61.72 64.03 146 9 LYS A 12 ? ? -65.53 90.83 147 9 PRO A 14 ? ? -55.98 174.15 148 9 MET A 36 ? ? -127.07 -162.96 149 9 PRO A 53 ? ? -69.91 27.24 150 9 GLU A 54 ? ? 59.96 8.56 151 9 ARG A 79 ? ? -82.24 -100.23 152 9 GLU A 80 ? ? -100.35 -94.53 153 9 ASP A 81 ? ? 173.36 -48.36 154 9 PRO A 83 ? ? -51.42 -177.20 155 9 LEU A 85 ? ? -139.29 -69.09 156 9 GLN A 87 ? ? -177.08 -168.13 157 9 ASN A 88 ? ? -155.25 34.15 158 9 ALA A 89 ? ? -172.18 129.83 159 10 LEU A 4 ? ? -177.35 137.76 160 10 LYS A 5 ? ? -158.21 27.40 161 10 LYS A 6 ? ? 58.42 -148.91 162 10 HIS A 7 ? ? 75.32 147.13 163 10 ASP A 9 ? ? 172.85 -47.18 164 10 PHE A 10 ? ? -161.05 62.67 165 10 PRO A 11 ? ? -54.41 -171.47 166 10 MET A 36 ? ? -128.46 -163.64 167 10 PRO A 53 ? ? -72.03 20.35 168 10 GLU A 54 ? ? 76.63 -9.09 169 10 ASN A 74 ? ? -98.04 -60.94 170 10 ARG A 79 ? ? -100.14 -100.10 171 10 GLU A 80 ? ? -100.36 -67.51 172 10 ASP A 81 ? ? 74.96 81.91 173 10 LEU A 85 ? ? -143.15 43.03 174 10 GLN A 87 ? ? 65.17 -77.69 175 10 ASN A 88 ? ? -153.63 -67.45 176 10 ALA A 89 ? ? -151.35 64.37 177 11 LYS A 2 ? ? -148.35 38.98 178 11 LYS A 6 ? ? 43.10 92.16 179 11 LYS A 12 ? ? -69.89 66.64 180 11 LYS A 13 ? ? -49.53 164.65 181 11 PRO A 14 ? ? -53.22 175.17 182 11 MET A 36 ? ? -130.24 -157.61 183 11 ASN A 38 ? ? 78.62 -14.99 184 11 PRO A 53 ? ? -70.19 23.37 185 11 GLU A 54 ? ? 56.74 12.85 186 11 LEU A 85 ? ? -149.01 24.71 187 11 ILE A 86 ? ? -150.61 -56.53 188 11 GLN A 87 ? ? 66.15 91.41 189 11 ASN A 88 ? ? 73.65 -55.10 190 11 ALA A 89 ? ? -54.49 -175.79 191 11 LYS A 90 ? ? -133.49 -46.42 192 12 LYS A 5 ? ? -171.82 -49.35 193 12 LYS A 6 ? ? -176.40 -148.68 194 12 HIS A 7 ? ? 74.69 150.12 195 12 ASP A 9 ? ? -67.88 77.47 196 12 PHE A 10 ? ? 60.94 70.29 197 12 PRO A 11 ? ? -68.77 -168.10 198 12 LYS A 13 ? ? -176.36 -58.59 199 12 PRO A 14 ? ? -58.44 173.03 200 12 HIS A 33 ? ? -116.58 58.32 201 12 PRO A 53 ? ? -66.05 26.02 202 12 GLU A 54 ? ? 55.64 14.79 203 12 ARG A 73 ? ? -57.17 -79.08 204 12 ARG A 79 ? ? -85.24 -93.10 205 12 GLU A 80 ? ? -100.28 -85.02 206 12 ASP A 81 ? ? 174.11 -56.68 207 12 ILE A 86 ? ? 47.60 105.84 208 12 GLN A 87 ? ? -61.47 -166.78 209 12 ASN A 88 ? ? -174.62 99.71 210 12 ALA A 89 ? ? 64.48 168.90 211 12 LYS A 90 ? ? -174.52 127.85 212 13 LEU A 4 ? ? -113.37 -166.11 213 13 LYS A 5 ? ? 70.82 74.10 214 13 PHE A 10 ? ? -167.99 90.13 215 13 LYS A 12 ? ? 179.43 97.27 216 13 LYS A 13 ? ? -142.01 -63.92 217 13 PRO A 14 ? ? -51.31 174.37 218 13 MET A 36 ? ? -114.93 -164.00 219 13 ASN A 38 ? ? 81.87 -18.76 220 13 PRO A 53 ? ? -70.43 24.52 221 13 GLU A 54 ? ? 57.19 12.67 222 13 GLN A 69 ? ? -100.20 -70.83 223 13 ARG A 73 ? ? -44.29 -79.91 224 13 PHE A 78 ? ? -55.33 -92.24 225 13 ARG A 79 ? ? -100.73 -100.31 226 13 GLU A 80 ? ? -100.71 -81.46 227 13 ASP A 81 ? ? 173.10 -51.64 228 13 HIS A 82 ? ? 179.65 96.10 229 13 ASP A 84 ? ? 179.63 36.27 230 13 ILE A 86 ? ? 74.69 -7.12 231 13 GLN A 87 ? ? 52.48 175.83 232 13 ASN A 88 ? ? 55.81 95.23 233 13 LYS A 90 ? ? 60.46 -178.17 234 14 LYS A 3 ? ? 61.84 115.12 235 14 LYS A 6 ? ? -177.03 100.93 236 14 ASP A 9 ? ? 61.77 152.58 237 14 PHE A 10 ? ? 59.22 77.13 238 14 LYS A 13 ? ? -163.05 -64.80 239 14 PRO A 14 ? ? -51.34 172.82 240 14 HIS A 33 ? ? -104.80 79.08 241 14 GLU A 35 ? ? -147.76 22.09 242 14 MET A 36 ? ? -110.70 -165.70 243 14 PRO A 53 ? ? -71.67 20.76 244 14 GLU A 54 ? ? 57.04 12.89 245 14 ARG A 73 ? ? -56.04 -79.54 246 14 ASP A 81 ? ? -69.21 -175.19 247 14 HIS A 82 ? ? -57.90 170.02 248 14 PRO A 83 ? ? -53.18 -172.57 249 14 ASP A 84 ? ? -56.03 106.47 250 14 ILE A 86 ? ? -140.19 36.10 251 14 ASN A 88 ? ? -131.57 -66.36 252 14 ALA A 89 ? ? -175.92 77.90 253 15 LEU A 4 ? ? 177.81 44.43 254 15 LYS A 5 ? ? -58.69 -73.30 255 15 LYS A 6 ? ? 47.30 27.88 256 15 PRO A 14 ? ? -44.11 169.75 257 15 LEU A 15 ? ? -83.37 -143.11 258 15 MET A 36 ? ? -121.72 -165.24 259 15 PRO A 53 ? ? -72.76 25.68 260 15 PHE A 64 ? ? -100.14 -61.75 261 15 ARG A 77 ? ? -38.04 -32.20 262 15 ASP A 81 ? ? 69.27 -67.46 263 15 ASP A 84 ? ? -176.65 47.87 264 15 LEU A 85 ? ? -163.29 110.63 265 15 ASN A 88 ? ? -169.51 80.20 266 16 LYS A 2 ? ? 61.16 88.40 267 16 LEU A 4 ? ? 60.36 108.38 268 16 PRO A 8 ? ? -66.47 63.62 269 16 ASP A 9 ? ? -139.81 -46.30 270 16 PHE A 10 ? ? -125.28 -61.45 271 16 PRO A 11 ? ? -99.16 -154.64 272 16 LYS A 12 ? ? 70.26 117.07 273 16 LYS A 13 ? ? 176.21 -63.04 274 16 MET A 36 ? ? -126.87 -163.98 275 16 PRO A 53 ? ? -66.37 21.68 276 16 GLU A 54 ? ? 54.51 15.58 277 16 ASP A 81 ? ? 54.76 86.63 278 16 HIS A 82 ? ? 58.79 163.89 279 16 PRO A 83 ? ? -53.69 106.36 280 16 LEU A 85 ? ? 59.38 -169.76 281 16 GLN A 87 ? ? 167.80 169.76 282 16 LYS A 90 ? ? -92.92 48.53 283 17 LYS A 3 ? ? 58.36 105.15 284 17 LYS A 5 ? ? 71.89 -74.58 285 17 HIS A 7 ? ? 113.50 -49.86 286 17 PHE A 10 ? ? -154.66 67.95 287 17 LYS A 13 ? ? 178.97 -58.16 288 17 PRO A 14 ? ? -48.02 174.38 289 17 MET A 36 ? ? -115.73 -165.94 290 17 ASN A 38 ? ? 78.94 -22.20 291 17 PRO A 53 ? ? -71.28 22.07 292 17 GLU A 54 ? ? 56.44 12.75 293 17 GLU A 80 ? ? -56.08 -78.26 294 17 HIS A 82 ? ? -178.64 82.26 295 17 PRO A 83 ? ? -52.34 93.43 296 17 LEU A 85 ? ? 67.73 138.76 297 17 ALA A 89 ? ? 61.89 151.44 298 18 LYS A 2 ? ? 35.17 92.73 299 18 LYS A 3 ? ? 66.57 149.90 300 18 LEU A 4 ? ? -145.75 49.18 301 18 LYS A 6 ? ? 62.48 144.71 302 18 HIS A 7 ? ? -92.14 -67.25 303 18 ASP A 9 ? ? -178.52 -46.66 304 18 LYS A 12 ? ? -149.21 36.56 305 18 MET A 36 ? ? -118.47 -165.85 306 18 ASN A 38 ? ? 82.56 -17.82 307 18 PRO A 53 ? ? -71.17 20.66 308 18 GLU A 54 ? ? 56.59 13.31 309 18 ARG A 73 ? ? -46.14 -72.90 310 18 PHE A 78 ? ? -30.77 -79.54 311 18 ARG A 79 ? ? -100.40 -100.41 312 18 GLU A 80 ? ? -100.79 -91.75 313 18 ASP A 81 ? ? 167.17 -173.22 314 18 HIS A 82 ? ? 178.59 123.22 315 18 PRO A 83 ? ? -77.64 -167.70 316 18 ASP A 84 ? ? -175.15 -62.27 317 18 LEU A 85 ? ? -174.72 -76.52 318 18 ASN A 88 ? ? -94.00 -92.27 319 18 ALA A 89 ? ? 57.39 167.76 320 19 LYS A 2 ? ? -109.36 -168.56 321 19 LYS A 3 ? ? 61.65 114.22 322 19 PRO A 8 ? ? -63.98 67.91 323 19 PRO A 11 ? ? -93.27 -154.43 324 19 LYS A 12 ? ? 79.78 -172.53 325 19 LYS A 13 ? ? 68.06 95.31 326 19 GLU A 35 ? ? -145.21 27.97 327 19 MET A 36 ? ? -123.29 -166.63 328 19 GLU A 54 ? ? 76.18 -8.03 329 19 GLN A 69 ? ? -100.29 -66.19 330 19 ARG A 73 ? ? -46.46 -86.74 331 19 LEU A 75 ? ? -85.32 -74.27 332 19 PHE A 78 ? ? -58.11 -86.87 333 19 ARG A 79 ? ? -100.56 -100.39 334 19 GLU A 80 ? ? -100.83 -70.10 335 19 ASP A 81 ? ? 77.25 108.59 336 19 HIS A 82 ? ? -170.96 -55.29 337 19 ASP A 84 ? ? 178.70 120.93 338 19 LEU A 85 ? ? -176.55 140.19 339 19 ILE A 86 ? ? 35.61 97.39 340 19 GLN A 87 ? ? -118.84 -166.90 341 19 ASN A 88 ? ? 65.03 100.77 342 20 LYS A 2 ? ? -173.17 117.04 343 20 LYS A 6 ? ? 61.44 66.27 344 20 LYS A 12 ? ? -58.11 -165.11 345 20 PRO A 14 ? ? -43.63 169.66 346 20 LEU A 15 ? ? -67.64 -142.14 347 20 HIS A 33 ? ? -118.02 73.26 348 20 MET A 36 ? ? -107.26 -161.40 349 20 ASN A 38 ? ? 82.65 -19.90 350 20 PRO A 53 ? ? -63.93 19.81 351 20 PHE A 64 ? ? -99.73 -68.76 352 20 ARG A 73 ? ? -51.27 -88.62 353 20 ARG A 79 ? ? -67.93 -89.40 354 20 ASP A 84 ? ? -146.10 -53.16 355 20 ILE A 86 ? ? -50.91 -75.27 356 20 GLN A 87 ? ? 169.21 -51.72 357 20 ALA A 89 ? ? -45.82 99.42 # _pdbx_nmr_ensemble.entry_id 1K99 _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1K99 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;3mM hUBF HMG box1 U-15N; 10mM NaPO4 buffer pH5.5; 90% H2O, 10%D2O ; '90% H2O/10% D2O' 2 ;3mM hUBF HMG box1 U-15N,13C; 10mM NaPO4 buffer pH5.5; 90% H2O, 10%D2O ; '90% H2O/10% D2O' 3 ;3mM hUBF HMG box1 U-15N; 10mM NaPO4 buffer pH5.5; 100% D2O ; '100% D2O' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 ambient 5.5 10mM ? K 2 305 ambient 5.5 10mM ? K 3 290 ambient 5.5 10mM ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 2 1 3D_13C-separated_NOESY 2 2 1 3D_15N-separated_NOESY 3 3 1 '2D NOESY' # _pdbx_nmr_refine.entry_id 1K99 _pdbx_nmr_refine.method ;simulated annealing; torsion angle dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.0 refinement 'Brunger, A.T.' 1 XwinNMR 1.3 collection Bruker 2 NMRPipe ? processing 'Delaglio, F. et al.' 3 PIPP ? 'data analysis' 'Garrett, D. et al.' 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 92 ? A LEU 92 2 1 Y 1 A GLU 93 ? A GLU 93 3 1 Y 1 A HIS 94 ? A HIS 94 4 1 Y 1 A HIS 95 ? A HIS 95 5 1 Y 1 A HIS 96 ? A HIS 96 6 1 Y 1 A HIS 97 ? A HIS 97 7 1 Y 1 A HIS 98 ? A HIS 98 8 1 Y 1 A HIS 99 ? A HIS 99 9 2 Y 1 A LEU 92 ? A LEU 92 10 2 Y 1 A GLU 93 ? A GLU 93 11 2 Y 1 A HIS 94 ? A HIS 94 12 2 Y 1 A HIS 95 ? A HIS 95 13 2 Y 1 A HIS 96 ? A HIS 96 14 2 Y 1 A HIS 97 ? A HIS 97 15 2 Y 1 A HIS 98 ? A HIS 98 16 2 Y 1 A HIS 99 ? A HIS 99 17 3 Y 1 A LEU 92 ? A LEU 92 18 3 Y 1 A GLU 93 ? A GLU 93 19 3 Y 1 A HIS 94 ? A HIS 94 20 3 Y 1 A HIS 95 ? A HIS 95 21 3 Y 1 A HIS 96 ? A HIS 96 22 3 Y 1 A HIS 97 ? A HIS 97 23 3 Y 1 A HIS 98 ? A HIS 98 24 3 Y 1 A HIS 99 ? A HIS 99 25 4 Y 1 A LEU 92 ? A LEU 92 26 4 Y 1 A GLU 93 ? A GLU 93 27 4 Y 1 A HIS 94 ? A HIS 94 28 4 Y 1 A HIS 95 ? A HIS 95 29 4 Y 1 A HIS 96 ? A HIS 96 30 4 Y 1 A HIS 97 ? A HIS 97 31 4 Y 1 A HIS 98 ? A HIS 98 32 4 Y 1 A HIS 99 ? A HIS 99 33 5 Y 1 A LEU 92 ? A LEU 92 34 5 Y 1 A GLU 93 ? A GLU 93 35 5 Y 1 A HIS 94 ? A HIS 94 36 5 Y 1 A HIS 95 ? A HIS 95 37 5 Y 1 A HIS 96 ? A HIS 96 38 5 Y 1 A HIS 97 ? A HIS 97 39 5 Y 1 A HIS 98 ? A HIS 98 40 5 Y 1 A HIS 99 ? A HIS 99 41 6 Y 1 A LEU 92 ? A LEU 92 42 6 Y 1 A GLU 93 ? A GLU 93 43 6 Y 1 A HIS 94 ? A HIS 94 44 6 Y 1 A HIS 95 ? A HIS 95 45 6 Y 1 A HIS 96 ? A HIS 96 46 6 Y 1 A HIS 97 ? A HIS 97 47 6 Y 1 A HIS 98 ? A HIS 98 48 6 Y 1 A HIS 99 ? A HIS 99 49 7 Y 1 A LEU 92 ? A LEU 92 50 7 Y 1 A GLU 93 ? A GLU 93 51 7 Y 1 A HIS 94 ? A HIS 94 52 7 Y 1 A HIS 95 ? A HIS 95 53 7 Y 1 A HIS 96 ? A HIS 96 54 7 Y 1 A HIS 97 ? A HIS 97 55 7 Y 1 A HIS 98 ? A HIS 98 56 7 Y 1 A HIS 99 ? A HIS 99 57 8 Y 1 A LEU 92 ? A LEU 92 58 8 Y 1 A GLU 93 ? A GLU 93 59 8 Y 1 A HIS 94 ? A HIS 94 60 8 Y 1 A HIS 95 ? A HIS 95 61 8 Y 1 A HIS 96 ? A HIS 96 62 8 Y 1 A HIS 97 ? A HIS 97 63 8 Y 1 A HIS 98 ? A HIS 98 64 8 Y 1 A HIS 99 ? A HIS 99 65 9 Y 1 A LEU 92 ? A LEU 92 66 9 Y 1 A GLU 93 ? A GLU 93 67 9 Y 1 A HIS 94 ? A HIS 94 68 9 Y 1 A HIS 95 ? A HIS 95 69 9 Y 1 A HIS 96 ? A HIS 96 70 9 Y 1 A HIS 97 ? A HIS 97 71 9 Y 1 A HIS 98 ? A HIS 98 72 9 Y 1 A HIS 99 ? A HIS 99 73 10 Y 1 A LEU 92 ? A LEU 92 74 10 Y 1 A GLU 93 ? A GLU 93 75 10 Y 1 A HIS 94 ? A HIS 94 76 10 Y 1 A HIS 95 ? A HIS 95 77 10 Y 1 A HIS 96 ? A HIS 96 78 10 Y 1 A HIS 97 ? A HIS 97 79 10 Y 1 A HIS 98 ? A HIS 98 80 10 Y 1 A HIS 99 ? A HIS 99 81 11 Y 1 A LEU 92 ? A LEU 92 82 11 Y 1 A GLU 93 ? A GLU 93 83 11 Y 1 A HIS 94 ? A HIS 94 84 11 Y 1 A HIS 95 ? A HIS 95 85 11 Y 1 A HIS 96 ? A HIS 96 86 11 Y 1 A HIS 97 ? A HIS 97 87 11 Y 1 A HIS 98 ? A HIS 98 88 11 Y 1 A HIS 99 ? A HIS 99 89 12 Y 1 A LEU 92 ? A LEU 92 90 12 Y 1 A GLU 93 ? A GLU 93 91 12 Y 1 A HIS 94 ? A HIS 94 92 12 Y 1 A HIS 95 ? A HIS 95 93 12 Y 1 A HIS 96 ? A HIS 96 94 12 Y 1 A HIS 97 ? A HIS 97 95 12 Y 1 A HIS 98 ? A HIS 98 96 12 Y 1 A HIS 99 ? A HIS 99 97 13 Y 1 A LEU 92 ? A LEU 92 98 13 Y 1 A GLU 93 ? A GLU 93 99 13 Y 1 A HIS 94 ? A HIS 94 100 13 Y 1 A HIS 95 ? A HIS 95 101 13 Y 1 A HIS 96 ? A HIS 96 102 13 Y 1 A HIS 97 ? A HIS 97 103 13 Y 1 A HIS 98 ? A HIS 98 104 13 Y 1 A HIS 99 ? A HIS 99 105 14 Y 1 A LEU 92 ? A LEU 92 106 14 Y 1 A GLU 93 ? A GLU 93 107 14 Y 1 A HIS 94 ? A HIS 94 108 14 Y 1 A HIS 95 ? A HIS 95 109 14 Y 1 A HIS 96 ? A HIS 96 110 14 Y 1 A HIS 97 ? A HIS 97 111 14 Y 1 A HIS 98 ? A HIS 98 112 14 Y 1 A HIS 99 ? A HIS 99 113 15 Y 1 A LEU 92 ? A LEU 92 114 15 Y 1 A GLU 93 ? A GLU 93 115 15 Y 1 A HIS 94 ? A HIS 94 116 15 Y 1 A HIS 95 ? A HIS 95 117 15 Y 1 A HIS 96 ? A HIS 96 118 15 Y 1 A HIS 97 ? A HIS 97 119 15 Y 1 A HIS 98 ? A HIS 98 120 15 Y 1 A HIS 99 ? A HIS 99 121 16 Y 1 A LEU 92 ? A LEU 92 122 16 Y 1 A GLU 93 ? A GLU 93 123 16 Y 1 A HIS 94 ? A HIS 94 124 16 Y 1 A HIS 95 ? A HIS 95 125 16 Y 1 A HIS 96 ? A HIS 96 126 16 Y 1 A HIS 97 ? A HIS 97 127 16 Y 1 A HIS 98 ? A HIS 98 128 16 Y 1 A HIS 99 ? A HIS 99 129 17 Y 1 A LEU 92 ? A LEU 92 130 17 Y 1 A GLU 93 ? A GLU 93 131 17 Y 1 A HIS 94 ? A HIS 94 132 17 Y 1 A HIS 95 ? A HIS 95 133 17 Y 1 A HIS 96 ? A HIS 96 134 17 Y 1 A HIS 97 ? A HIS 97 135 17 Y 1 A HIS 98 ? A HIS 98 136 17 Y 1 A HIS 99 ? A HIS 99 137 18 Y 1 A LEU 92 ? A LEU 92 138 18 Y 1 A GLU 93 ? A GLU 93 139 18 Y 1 A HIS 94 ? A HIS 94 140 18 Y 1 A HIS 95 ? A HIS 95 141 18 Y 1 A HIS 96 ? A HIS 96 142 18 Y 1 A HIS 97 ? A HIS 97 143 18 Y 1 A HIS 98 ? A HIS 98 144 18 Y 1 A HIS 99 ? A HIS 99 145 19 Y 1 A LEU 92 ? A LEU 92 146 19 Y 1 A GLU 93 ? A GLU 93 147 19 Y 1 A HIS 94 ? A HIS 94 148 19 Y 1 A HIS 95 ? A HIS 95 149 19 Y 1 A HIS 96 ? A HIS 96 150 19 Y 1 A HIS 97 ? A HIS 97 151 19 Y 1 A HIS 98 ? A HIS 98 152 19 Y 1 A HIS 99 ? A HIS 99 153 20 Y 1 A LEU 92 ? A LEU 92 154 20 Y 1 A GLU 93 ? A GLU 93 155 20 Y 1 A HIS 94 ? A HIS 94 156 20 Y 1 A HIS 95 ? A HIS 95 157 20 Y 1 A HIS 96 ? A HIS 96 158 20 Y 1 A HIS 97 ? A HIS 97 159 20 Y 1 A HIS 98 ? A HIS 98 160 20 Y 1 A HIS 99 ? A HIS 99 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 PRO N N N N 246 PRO CA C N S 247 PRO C C N N 248 PRO O O N N 249 PRO CB C N N 250 PRO CG C N N 251 PRO CD C N N 252 PRO OXT O N N 253 PRO H H N N 254 PRO HA H N N 255 PRO HB2 H N N 256 PRO HB3 H N N 257 PRO HG2 H N N 258 PRO HG3 H N N 259 PRO HD2 H N N 260 PRO HD3 H N N 261 PRO HXT H N N 262 SER N N N N 263 SER CA C N S 264 SER C C N N 265 SER O O N N 266 SER CB C N N 267 SER OG O N N 268 SER OXT O N N 269 SER H H N N 270 SER H2 H N N 271 SER HA H N N 272 SER HB2 H N N 273 SER HB3 H N N 274 SER HG H N N 275 SER HXT H N N 276 THR N N N N 277 THR CA C N S 278 THR C C N N 279 THR O O N N 280 THR CB C N R 281 THR OG1 O N N 282 THR CG2 C N N 283 THR OXT O N N 284 THR H H N N 285 THR H2 H N N 286 THR HA H N N 287 THR HB H N N 288 THR HG1 H N N 289 THR HG21 H N N 290 THR HG22 H N N 291 THR HG23 H N N 292 THR HXT H N N 293 TYR N N N N 294 TYR CA C N S 295 TYR C C N N 296 TYR O O N N 297 TYR CB C N N 298 TYR CG C Y N 299 TYR CD1 C Y N 300 TYR CD2 C Y N 301 TYR CE1 C Y N 302 TYR CE2 C Y N 303 TYR CZ C Y N 304 TYR OH O N N 305 TYR OXT O N N 306 TYR H H N N 307 TYR H2 H N N 308 TYR HA H N N 309 TYR HB2 H N N 310 TYR HB3 H N N 311 TYR HD1 H N N 312 TYR HD2 H N N 313 TYR HE1 H N N 314 TYR HE2 H N N 315 TYR HH H N N 316 TYR HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 ILE N CA sing N N 128 ILE N H sing N N 129 ILE N H2 sing N N 130 ILE CA C sing N N 131 ILE CA CB sing N N 132 ILE CA HA sing N N 133 ILE C O doub N N 134 ILE C OXT sing N N 135 ILE CB CG1 sing N N 136 ILE CB CG2 sing N N 137 ILE CB HB sing N N 138 ILE CG1 CD1 sing N N 139 ILE CG1 HG12 sing N N 140 ILE CG1 HG13 sing N N 141 ILE CG2 HG21 sing N N 142 ILE CG2 HG22 sing N N 143 ILE CG2 HG23 sing N N 144 ILE CD1 HD11 sing N N 145 ILE CD1 HD12 sing N N 146 ILE CD1 HD13 sing N N 147 ILE OXT HXT sing N N 148 LEU N CA sing N N 149 LEU N H sing N N 150 LEU N H2 sing N N 151 LEU CA C sing N N 152 LEU CA CB sing N N 153 LEU CA HA sing N N 154 LEU C O doub N N 155 LEU C OXT sing N N 156 LEU CB CG sing N N 157 LEU CB HB2 sing N N 158 LEU CB HB3 sing N N 159 LEU CG CD1 sing N N 160 LEU CG CD2 sing N N 161 LEU CG HG sing N N 162 LEU CD1 HD11 sing N N 163 LEU CD1 HD12 sing N N 164 LEU CD1 HD13 sing N N 165 LEU CD2 HD21 sing N N 166 LEU CD2 HD22 sing N N 167 LEU CD2 HD23 sing N N 168 LEU OXT HXT sing N N 169 LYS N CA sing N N 170 LYS N H sing N N 171 LYS N H2 sing N N 172 LYS CA C sing N N 173 LYS CA CB sing N N 174 LYS CA HA sing N N 175 LYS C O doub N N 176 LYS C OXT sing N N 177 LYS CB CG sing N N 178 LYS CB HB2 sing N N 179 LYS CB HB3 sing N N 180 LYS CG CD sing N N 181 LYS CG HG2 sing N N 182 LYS CG HG3 sing N N 183 LYS CD CE sing N N 184 LYS CD HD2 sing N N 185 LYS CD HD3 sing N N 186 LYS CE NZ sing N N 187 LYS CE HE2 sing N N 188 LYS CE HE3 sing N N 189 LYS NZ HZ1 sing N N 190 LYS NZ HZ2 sing N N 191 LYS NZ HZ3 sing N N 192 LYS OXT HXT sing N N 193 MET N CA sing N N 194 MET N H sing N N 195 MET N H2 sing N N 196 MET CA C sing N N 197 MET CA CB sing N N 198 MET CA HA sing N N 199 MET C O doub N N 200 MET C OXT sing N N 201 MET CB CG sing N N 202 MET CB HB2 sing N N 203 MET CB HB3 sing N N 204 MET CG SD sing N N 205 MET CG HG2 sing N N 206 MET CG HG3 sing N N 207 MET SD CE sing N N 208 MET CE HE1 sing N N 209 MET CE HE2 sing N N 210 MET CE HE3 sing N N 211 MET OXT HXT sing N N 212 PHE N CA sing N N 213 PHE N H sing N N 214 PHE N H2 sing N N 215 PHE CA C sing N N 216 PHE CA CB sing N N 217 PHE CA HA sing N N 218 PHE C O doub N N 219 PHE C OXT sing N N 220 PHE CB CG sing N N 221 PHE CB HB2 sing N N 222 PHE CB HB3 sing N N 223 PHE CG CD1 doub Y N 224 PHE CG CD2 sing Y N 225 PHE CD1 CE1 sing Y N 226 PHE CD1 HD1 sing N N 227 PHE CD2 CE2 doub Y N 228 PHE CD2 HD2 sing N N 229 PHE CE1 CZ doub Y N 230 PHE CE1 HE1 sing N N 231 PHE CE2 CZ sing Y N 232 PHE CE2 HE2 sing N N 233 PHE CZ HZ sing N N 234 PHE OXT HXT sing N N 235 PRO N CA sing N N 236 PRO N CD sing N N 237 PRO N H sing N N 238 PRO CA C sing N N 239 PRO CA CB sing N N 240 PRO CA HA sing N N 241 PRO C O doub N N 242 PRO C OXT sing N N 243 PRO CB CG sing N N 244 PRO CB HB2 sing N N 245 PRO CB HB3 sing N N 246 PRO CG CD sing N N 247 PRO CG HG2 sing N N 248 PRO CG HG3 sing N N 249 PRO CD HD2 sing N N 250 PRO CD HD3 sing N N 251 PRO OXT HXT sing N N 252 SER N CA sing N N 253 SER N H sing N N 254 SER N H2 sing N N 255 SER CA C sing N N 256 SER CA CB sing N N 257 SER CA HA sing N N 258 SER C O doub N N 259 SER C OXT sing N N 260 SER CB OG sing N N 261 SER CB HB2 sing N N 262 SER CB HB3 sing N N 263 SER OG HG sing N N 264 SER OXT HXT sing N N 265 THR N CA sing N N 266 THR N H sing N N 267 THR N H2 sing N N 268 THR CA C sing N N 269 THR CA CB sing N N 270 THR CA HA sing N N 271 THR C O doub N N 272 THR C OXT sing N N 273 THR CB OG1 sing N N 274 THR CB CG2 sing N N 275 THR CB HB sing N N 276 THR OG1 HG1 sing N N 277 THR CG2 HG21 sing N N 278 THR CG2 HG22 sing N N 279 THR CG2 HG23 sing N N 280 THR OXT HXT sing N N 281 TYR N CA sing N N 282 TYR N H sing N N 283 TYR N H2 sing N N 284 TYR CA C sing N N 285 TYR CA CB sing N N 286 TYR CA HA sing N N 287 TYR C O doub N N 288 TYR C OXT sing N N 289 TYR CB CG sing N N 290 TYR CB HB2 sing N N 291 TYR CB HB3 sing N N 292 TYR CG CD1 doub Y N 293 TYR CG CD2 sing Y N 294 TYR CD1 CE1 sing Y N 295 TYR CD1 HD1 sing N N 296 TYR CD2 CE2 doub Y N 297 TYR CD2 HD2 sing N N 298 TYR CE1 CZ doub Y N 299 TYR CE1 HE1 sing N N 300 TYR CE2 CZ sing Y N 301 TYR CE2 HE2 sing N N 302 TYR CZ OH sing N N 303 TYR OH HH sing N N 304 TYR OXT HXT sing N N 305 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.field_strength 500 # _atom_sites.entry_id 1K99 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_