data_1KQ8 # _entry.id 1KQ8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KQ8 pdb_00001kq8 10.2210/pdb1kq8/pdb RCSB RCSB015223 ? ? WWPDB D_1000015223 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KQ8 _pdbx_database_status.recvd_initial_deposition_date 2002-01-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sheng, W.' 1 'Rance, M.' 2 'Liao, X.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Structure comparison of two conserved HNF-3/fkh proteins HFH-1 and genesis indicates the existence of folding differences in their complexes with a DNA binding sequence. ; Biochemistry 41 3286 3293 2002 BICHAW US 0006-2960 0033 ? 11876636 10.1021/bi011908k 1 ;Structural changes in the region directly adjacent to the DNA-binding helix highlight a possible mechanism to explain the observed changes in the sequence-specific binding of winged helix proteins ; J.Mol.Biol. 278 293 299 1998 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.1998.1703 2 'Sequence specific collective motions in a winged helix DNA binding domain detected by 15N relaxation NMR' Biochemistry 37 6179 6187 1998 BICHAW US 0006-2960 0033 ? ? 10.1021/bi980031v # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sheng, W.' 1 ? primary 'Rance, M.' 2 ? primary 'Liao, X.' 3 ? 1 'Marsden, I.' 4 ? 1 'Jin, C.' 5 ? 1 'Liao, X.' 6 ? 2 'Jin, C.' 7 ? 2 'Marsden, I.' 8 ? 2 'Chen, X.' 9 ? 2 'Liao, X.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HEPATOCYTE NUCLEAR FACTOR 3 FORKHEAD HOMOLOG 1' _entity.formula_weight 11804.493 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HFH-1; HNF-3/forkhead homolog-1; winged helix/forkhead transcription factor' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PKPPYSYIALITMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLN PNSEYTFADGVFRRRRYRLS ; _entity_poly.pdbx_seq_one_letter_code_can ;PKPPYSYIALITMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLN PNSEYTFADGVFRRRRYRLS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LYS n 1 3 PRO n 1 4 PRO n 1 5 TYR n 1 6 SER n 1 7 TYR n 1 8 ILE n 1 9 ALA n 1 10 LEU n 1 11 ILE n 1 12 THR n 1 13 MET n 1 14 ALA n 1 15 ILE n 1 16 ARG n 1 17 ASP n 1 18 SER n 1 19 ALA n 1 20 GLY n 1 21 GLY n 1 22 ARG n 1 23 LEU n 1 24 THR n 1 25 LEU n 1 26 ALA n 1 27 GLU n 1 28 ILE n 1 29 ASN n 1 30 GLU n 1 31 TYR n 1 32 LEU n 1 33 MET n 1 34 GLY n 1 35 LYS n 1 36 PHE n 1 37 PRO n 1 38 PHE n 1 39 PHE n 1 40 ARG n 1 41 GLY n 1 42 SER n 1 43 TYR n 1 44 THR n 1 45 GLY n 1 46 TRP n 1 47 ARG n 1 48 ASN n 1 49 SER n 1 50 VAL n 1 51 ARG n 1 52 HIS n 1 53 ASN n 1 54 LEU n 1 55 SER n 1 56 LEU n 1 57 ASN n 1 58 ASP n 1 59 CYS n 1 60 PHE n 1 61 VAL n 1 62 LYS n 1 63 VAL n 1 64 LEU n 1 65 ARG n 1 66 ASP n 1 67 PRO n 1 68 SER n 1 69 ARG n 1 70 PRO n 1 71 TRP n 1 72 GLY n 1 73 LYS n 1 74 ASP n 1 75 ASN n 1 76 TYR n 1 77 TRP n 1 78 MET n 1 79 LEU n 1 80 ASN n 1 81 PRO n 1 82 ASN n 1 83 SER n 1 84 GLU n 1 85 TYR n 1 86 THR n 1 87 PHE n 1 88 ALA n 1 89 ASP n 1 90 GLY n 1 91 VAL n 1 92 PHE n 1 93 ARG n 1 94 ARG n 1 95 ARG n 1 96 ARG n 1 97 TYR n 1 98 ARG n 1 99 LEU n 1 100 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name UNP _struct_ref.db_code FOXQ1_RAT _struct_ref.pdbx_db_accession Q63244 _struct_ref.pdbx_align_begin 99 _struct_ref.pdbx_seq_one_letter_code ;PKPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLN PNSEYTFADGVFRRRRKRLS ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KQ8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q63244 _struct_ref_seq.db_align_beg 99 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 198 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KQ8 THR A 12 ? UNP Q63244 ALA 110 conflict 13 1 1 1KQ8 TYR A 97 ? UNP Q63244 LYS 195 conflict 98 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 2 3D_13C-separated_NOESY 3 3 3 HNCA-J 4 4 4 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 290 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DMX 750 3 ? Varian UNITYPLUS 800 # _pdbx_nmr_refine.entry_id 1KQ8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1KQ8 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_software.name DYANA _pdbx_nmr_software.version 1.5 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Gunter, P.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1KQ8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1KQ8 _struct.title 'Solution Structure of Winged Helix Protein HFH-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KQ8 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Winged Helix Protein, HFH-1, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 7 ? ARG A 16 ? TYR A 8 ARG A 17 1 ? 10 HELX_P HELX_P2 2 THR A 24 ? PHE A 36 ? THR A 25 PHE A 37 1 ? 13 HELX_P HELX_P3 3 PHE A 38 ? SER A 42 ? PHE A 39 SER A 43 5 ? 5 HELX_P HELX_P4 4 TRP A 46 ? ASP A 58 ? TRP A 47 ASP A 59 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 61 ? LYS A 62 ? VAL A 62 LYS A 63 A 2 TRP A 77 ? MET A 78 ? TRP A 78 MET A 79 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 61 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 62 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 78 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 79 # _atom_sites.entry_id 1KQ8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 2 ? ? ? A . n A 1 2 LYS 2 3 ? ? ? A . n A 1 3 PRO 3 4 ? ? ? A . n A 1 4 PRO 4 5 ? ? ? A . n A 1 5 TYR 5 6 ? ? ? A . n A 1 6 SER 6 7 ? ? ? A . n A 1 7 TYR 7 8 8 TYR TYR A . n A 1 8 ILE 8 9 9 ILE ILE A . n A 1 9 ALA 9 10 10 ALA ALA A . n A 1 10 LEU 10 11 11 LEU LEU A . n A 1 11 ILE 11 12 12 ILE ILE A . n A 1 12 THR 12 13 13 THR THR A . n A 1 13 MET 13 14 14 MET MET A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 ILE 15 16 16 ILE ILE A . n A 1 16 ARG 16 17 17 ARG ARG A . n A 1 17 ASP 17 18 18 ASP ASP A . n A 1 18 SER 18 19 19 SER SER A . n A 1 19 ALA 19 20 20 ALA ALA A . n A 1 20 GLY 20 21 21 GLY GLY A . n A 1 21 GLY 21 22 22 GLY GLY A . n A 1 22 ARG 22 23 23 ARG ARG A . n A 1 23 LEU 23 24 24 LEU LEU A . n A 1 24 THR 24 25 25 THR THR A . n A 1 25 LEU 25 26 26 LEU LEU A . n A 1 26 ALA 26 27 27 ALA ALA A . n A 1 27 GLU 27 28 28 GLU GLU A . n A 1 28 ILE 28 29 29 ILE ILE A . n A 1 29 ASN 29 30 30 ASN ASN A . n A 1 30 GLU 30 31 31 GLU GLU A . n A 1 31 TYR 31 32 32 TYR TYR A . n A 1 32 LEU 32 33 33 LEU LEU A . n A 1 33 MET 33 34 34 MET MET A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 LYS 35 36 36 LYS LYS A . n A 1 36 PHE 36 37 37 PHE PHE A . n A 1 37 PRO 37 38 38 PRO PRO A . n A 1 38 PHE 38 39 39 PHE PHE A . n A 1 39 PHE 39 40 40 PHE PHE A . n A 1 40 ARG 40 41 41 ARG ARG A . n A 1 41 GLY 41 42 42 GLY GLY A . n A 1 42 SER 42 43 43 SER SER A . n A 1 43 TYR 43 44 44 TYR TYR A . n A 1 44 THR 44 45 45 THR THR A . n A 1 45 GLY 45 46 46 GLY GLY A . n A 1 46 TRP 46 47 47 TRP TRP A . n A 1 47 ARG 47 48 48 ARG ARG A . n A 1 48 ASN 48 49 49 ASN ASN A . n A 1 49 SER 49 50 50 SER SER A . n A 1 50 VAL 50 51 51 VAL VAL A . n A 1 51 ARG 51 52 52 ARG ARG A . n A 1 52 HIS 52 53 53 HIS HIS A . n A 1 53 ASN 53 54 54 ASN ASN A . n A 1 54 LEU 54 55 55 LEU LEU A . n A 1 55 SER 55 56 56 SER SER A . n A 1 56 LEU 56 57 57 LEU LEU A . n A 1 57 ASN 57 58 58 ASN ASN A . n A 1 58 ASP 58 59 59 ASP ASP A . n A 1 59 CYS 59 60 60 CYS CYS A . n A 1 60 PHE 60 61 61 PHE PHE A . n A 1 61 VAL 61 62 62 VAL VAL A . n A 1 62 LYS 62 63 63 LYS LYS A . n A 1 63 VAL 63 64 64 VAL VAL A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ARG 65 66 66 ARG ARG A . n A 1 66 ASP 66 67 67 ASP ASP A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 SER 68 69 69 SER SER A . n A 1 69 ARG 69 70 70 ARG ARG A . n A 1 70 PRO 70 71 71 PRO PRO A . n A 1 71 TRP 71 72 72 TRP TRP A . n A 1 72 GLY 72 73 73 GLY GLY A . n A 1 73 LYS 73 74 74 LYS LYS A . n A 1 74 ASP 74 75 75 ASP ASP A . n A 1 75 ASN 75 76 76 ASN ASN A . n A 1 76 TYR 76 77 77 TYR TYR A . n A 1 77 TRP 77 78 78 TRP TRP A . n A 1 78 MET 78 79 79 MET MET A . n A 1 79 LEU 79 80 80 LEU LEU A . n A 1 80 ASN 80 81 81 ASN ASN A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 ASN 82 83 ? ? ? A . n A 1 83 SER 83 84 ? ? ? A . n A 1 84 GLU 84 85 ? ? ? A . n A 1 85 TYR 85 86 ? ? ? A . n A 1 86 THR 86 87 ? ? ? A . n A 1 87 PHE 87 88 ? ? ? A . n A 1 88 ALA 88 89 ? ? ? A . n A 1 89 ASP 89 90 ? ? ? A . n A 1 90 GLY 90 91 ? ? ? A . n A 1 91 VAL 91 92 ? ? ? A . n A 1 92 PHE 92 93 ? ? ? A . n A 1 93 ARG 93 94 ? ? ? A . n A 1 94 ARG 94 95 ? ? ? A . n A 1 95 ARG 95 96 ? ? ? A . n A 1 96 ARG 96 97 ? ? ? A . n A 1 97 TYR 97 98 ? ? ? A . n A 1 98 ARG 98 99 ? ? ? A . n A 1 99 LEU 99 100 ? ? ? A . n A 1 100 SER 100 101 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-01-22 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 24 ? ? H A TRP 78 ? ? 1.47 2 1 O A TRP 47 ? ? H A VAL 51 ? ? 1.51 3 2 O A TRP 47 ? ? H A VAL 51 ? ? 1.48 4 2 O A PHE 39 ? ? HG A SER 43 ? ? 1.49 5 3 O A TRP 47 ? ? H A VAL 51 ? ? 1.43 6 4 O A LEU 24 ? ? H A TRP 78 ? ? 1.46 7 4 H A VAL 64 ? ? O A TYR 77 ? ? 1.56 8 4 O A TRP 47 ? ? H A VAL 51 ? ? 1.57 9 5 O A PHE 39 ? ? H A SER 43 ? ? 1.51 10 5 O A TRP 47 ? ? H A VAL 51 ? ? 1.54 11 6 O A TRP 47 ? ? H A VAL 51 ? ? 1.51 12 6 H A VAL 64 ? ? O A TYR 77 ? ? 1.53 13 6 O A LEU 24 ? ? H A TRP 78 ? ? 1.53 14 7 O A LEU 24 ? ? H A TRP 78 ? ? 1.55 15 7 O A TRP 47 ? ? H A VAL 51 ? ? 1.56 16 9 OD2 A ASP 67 ? ? HH A TYR 77 ? ? 1.49 17 9 O A TRP 47 ? ? H A VAL 51 ? ? 1.56 18 10 O A LEU 24 ? ? H A TRP 78 ? ? 1.46 19 10 O A TYR 44 ? ? HE1 A TRP 47 ? ? 1.53 20 10 O A TRP 47 ? ? H A VAL 51 ? ? 1.54 21 11 O A THR 25 ? ? H A ILE 29 ? ? 1.48 22 11 O A TRP 47 ? ? H A VAL 51 ? ? 1.52 23 12 O A TRP 47 ? ? H A VAL 51 ? ? 1.50 24 12 O A LEU 33 ? ? H A PHE 37 ? ? 1.58 25 13 O A TRP 47 ? ? H A VAL 51 ? ? 1.47 26 14 O A TRP 47 ? ? H A VAL 51 ? ? 1.47 27 15 O A TRP 47 ? ? H A VAL 51 ? ? 1.52 28 16 O A TRP 47 ? ? H A VAL 51 ? ? 1.50 29 16 O A LEU 24 ? ? H A TRP 78 ? ? 1.60 30 17 O A TRP 47 ? ? H A VAL 51 ? ? 1.48 31 17 O A LEU 24 ? ? H A TRP 78 ? ? 1.53 32 18 O A LEU 24 ? ? H A TRP 78 ? ? 1.49 33 18 O A TRP 47 ? ? H A VAL 51 ? ? 1.49 34 18 O A ILE 16 ? ? H A SER 19 ? ? 1.51 35 19 O A TRP 47 ? ? H A VAL 51 ? ? 1.55 36 20 O A TRP 47 ? ? H A VAL 51 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 19 ? ? -89.09 -142.05 2 1 ALA A 20 ? ? -168.50 33.61 3 1 SER A 43 ? ? -143.50 -69.55 4 1 TYR A 44 ? ? -169.93 107.99 5 1 ASN A 58 ? ? -108.43 -76.16 6 1 CYS A 60 ? ? 88.93 59.77 7 1 PHE A 61 ? ? -119.19 -169.52 8 1 ARG A 66 ? ? 40.34 89.01 9 1 SER A 69 ? ? -177.59 65.74 10 1 TRP A 72 ? ? 91.33 -36.89 11 1 LYS A 74 ? ? 177.30 51.20 12 2 SER A 19 ? ? -86.23 -144.33 13 2 ALA A 20 ? ? -166.07 31.68 14 2 SER A 43 ? ? -135.47 -79.93 15 2 TYR A 44 ? ? -165.65 119.44 16 2 ASN A 58 ? ? -99.21 -88.93 17 2 CYS A 60 ? ? 92.46 64.47 18 2 PHE A 61 ? ? -119.22 -165.33 19 2 ARG A 66 ? ? 49.01 95.42 20 2 SER A 69 ? ? -176.32 58.05 21 2 ARG A 70 ? ? -170.45 65.35 22 2 TRP A 72 ? ? 48.63 25.16 23 2 LYS A 74 ? ? -161.57 42.45 24 2 ASP A 75 ? ? -175.61 -68.85 25 3 SER A 19 ? ? -82.79 -143.28 26 3 ALA A 20 ? ? -169.32 32.91 27 3 SER A 43 ? ? -150.30 -72.97 28 3 TYR A 44 ? ? -174.81 117.65 29 3 ASN A 58 ? ? -98.39 -89.84 30 3 CYS A 60 ? ? 91.40 63.88 31 3 PHE A 61 ? ? -119.73 -165.33 32 3 SER A 69 ? ? 177.50 41.04 33 3 ARG A 70 ? ? -171.57 68.52 34 3 TRP A 72 ? ? 80.63 -38.58 35 3 LYS A 74 ? ? -173.24 -40.74 36 3 ASN A 81 ? ? -167.49 75.97 37 4 ALA A 20 ? ? 82.19 43.24 38 4 SER A 43 ? ? -69.90 -76.82 39 4 THR A 45 ? ? -94.02 48.67 40 4 ASN A 58 ? ? -93.06 -80.97 41 4 CYS A 60 ? ? 95.77 78.90 42 4 PHE A 61 ? ? -123.96 -166.52 43 4 ARG A 66 ? ? -154.97 75.80 44 4 SER A 69 ? ? -167.25 41.81 45 4 ARG A 70 ? ? -165.32 67.31 46 4 TRP A 72 ? ? -178.52 -40.06 47 4 LYS A 74 ? ? -173.34 -40.16 48 5 SER A 19 ? ? -86.19 -149.71 49 5 ALA A 20 ? ? -154.45 23.18 50 5 SER A 43 ? ? -69.48 -74.80 51 5 TYR A 44 ? ? -174.67 132.81 52 5 THR A 45 ? ? -98.66 47.87 53 5 CYS A 60 ? ? 90.40 69.90 54 5 ARG A 66 ? ? 40.74 71.14 55 6 SER A 19 ? ? -95.04 -146.12 56 6 ALA A 20 ? ? -155.96 25.60 57 6 SER A 43 ? ? -69.81 -75.73 58 6 TYR A 44 ? ? -170.10 123.37 59 6 THR A 45 ? ? -91.23 33.14 60 6 ASN A 58 ? ? -80.62 -72.55 61 6 CYS A 60 ? ? 88.20 57.91 62 6 PHE A 61 ? ? -119.23 -167.71 63 6 ARG A 66 ? ? 61.18 107.96 64 6 ASP A 67 ? ? 172.64 -54.05 65 6 ARG A 70 ? ? 38.46 62.10 66 6 PRO A 71 ? ? -75.04 -166.51 67 6 LYS A 74 ? ? -166.45 -42.88 68 7 SER A 19 ? ? -83.80 -149.63 69 7 ALA A 20 ? ? -166.25 30.14 70 7 SER A 43 ? ? -155.41 -71.47 71 7 TYR A 44 ? ? -163.99 105.99 72 7 ASN A 58 ? ? -106.82 -74.16 73 7 CYS A 60 ? ? 91.30 65.33 74 7 PHE A 61 ? ? -119.12 -166.19 75 7 ASP A 67 ? ? 177.49 108.15 76 7 TRP A 72 ? ? -178.36 38.73 77 7 LYS A 74 ? ? -173.39 -46.60 78 7 ASP A 75 ? ? -161.78 -66.52 79 8 SER A 19 ? ? -84.30 -144.82 80 8 ALA A 20 ? ? -167.86 31.49 81 8 SER A 43 ? ? -138.25 -76.81 82 8 TYR A 44 ? ? -168.33 118.51 83 8 ASN A 58 ? ? -96.46 -92.26 84 8 CYS A 60 ? ? 88.82 62.44 85 8 PHE A 61 ? ? -119.22 -164.74 86 8 LEU A 65 ? ? -39.46 152.82 87 8 ARG A 66 ? ? -52.22 106.50 88 8 SER A 69 ? ? -172.80 -72.99 89 8 ARG A 70 ? ? -38.69 99.14 90 8 LYS A 74 ? ? -150.98 22.60 91 8 ASP A 75 ? ? -166.30 -65.20 92 9 SER A 19 ? ? -88.35 -146.12 93 9 ALA A 20 ? ? -168.84 36.41 94 9 SER A 43 ? ? -139.34 -66.40 95 9 THR A 45 ? ? -82.80 48.68 96 9 TRP A 47 ? ? -101.69 -82.45 97 9 ASN A 58 ? ? -95.42 -88.98 98 9 CYS A 60 ? ? 88.06 84.79 99 9 PHE A 61 ? ? -127.09 -167.19 100 9 SER A 69 ? ? -174.85 69.30 101 9 ARG A 70 ? ? -160.00 64.46 102 9 LYS A 74 ? ? -151.32 38.22 103 10 SER A 19 ? ? -85.14 -143.68 104 10 ALA A 20 ? ? -170.25 33.07 105 10 SER A 43 ? ? -134.65 -64.82 106 10 TYR A 44 ? ? -38.38 96.41 107 10 THR A 45 ? ? -134.60 -42.81 108 10 ASN A 58 ? ? -89.51 -77.36 109 10 PHE A 61 ? ? -118.75 -165.94 110 10 ARG A 66 ? ? 42.49 77.62 111 10 SER A 69 ? ? -132.55 -46.51 112 10 LYS A 74 ? ? 172.10 47.66 113 10 ASP A 75 ? ? -178.58 145.21 114 10 ASN A 81 ? ? -172.68 144.50 115 11 SER A 19 ? ? -91.87 -146.03 116 11 ALA A 20 ? ? -170.08 32.97 117 11 SER A 43 ? ? -156.45 -82.13 118 11 ASN A 58 ? ? -106.14 -67.67 119 11 CYS A 60 ? ? 85.72 64.14 120 11 PHE A 61 ? ? -119.33 -163.26 121 11 LEU A 65 ? ? -151.65 24.85 122 11 SER A 69 ? ? -178.32 56.14 123 11 LYS A 74 ? ? 173.44 -42.35 124 12 ALA A 20 ? ? 90.34 43.07 125 12 SER A 43 ? ? -152.14 -75.13 126 12 TYR A 44 ? ? -173.12 115.43 127 12 ASN A 58 ? ? -123.73 -54.13 128 12 CYS A 60 ? ? 75.56 69.92 129 12 PHE A 61 ? ? -127.31 -165.46 130 12 ASP A 67 ? ? 178.87 80.30 131 12 ARG A 70 ? ? -157.85 63.37 132 12 PRO A 71 ? ? -74.94 -169.08 133 12 LYS A 74 ? ? -159.75 46.41 134 13 SER A 19 ? ? -91.77 -144.73 135 13 ALA A 20 ? ? -173.05 34.51 136 13 SER A 43 ? ? -126.95 -85.87 137 13 THR A 45 ? ? -91.13 53.27 138 13 ASN A 58 ? ? -60.10 -86.79 139 13 CYS A 60 ? ? 98.49 56.07 140 13 PHE A 61 ? ? -119.11 -166.45 141 13 ARG A 66 ? ? 48.83 94.56 142 13 SER A 69 ? ? -136.62 -51.00 143 13 TRP A 72 ? ? -176.14 38.77 144 13 LYS A 74 ? ? 179.71 -53.34 145 13 ASP A 75 ? ? -153.95 -64.29 146 14 ALA A 20 ? ? 82.99 41.61 147 14 SER A 43 ? ? -69.71 -76.63 148 14 THR A 45 ? ? -94.83 39.82 149 14 ASN A 58 ? ? -77.02 -76.00 150 14 CYS A 60 ? ? 84.65 61.25 151 14 PHE A 61 ? ? -119.32 -165.50 152 14 LEU A 65 ? ? -156.96 62.24 153 14 ARG A 66 ? ? 176.84 99.90 154 14 ASP A 67 ? ? 172.84 155.01 155 14 SER A 69 ? ? 174.10 75.68 156 14 ARG A 70 ? ? 168.73 -53.90 157 14 LYS A 74 ? ? 175.30 41.12 158 15 ALA A 20 ? ? 91.87 45.33 159 15 SER A 43 ? ? -70.04 -76.59 160 15 THR A 45 ? ? -89.39 37.95 161 15 ASN A 58 ? ? -103.44 -81.44 162 15 CYS A 60 ? ? 92.98 66.59 163 15 PHE A 61 ? ? -119.50 -164.58 164 15 LEU A 65 ? ? -62.70 83.43 165 15 ARG A 66 ? ? 34.85 69.85 166 15 ARG A 70 ? ? -47.96 105.10 167 15 LYS A 74 ? ? -163.62 57.32 168 15 ASN A 81 ? ? -175.38 133.12 169 16 SER A 19 ? ? -74.20 -145.98 170 16 ALA A 20 ? ? -166.53 30.89 171 16 SER A 43 ? ? -125.99 -56.52 172 16 TYR A 44 ? ? -59.88 81.49 173 16 ASN A 58 ? ? -108.60 -79.31 174 16 CYS A 60 ? ? 89.12 66.29 175 16 PHE A 61 ? ? -122.59 -164.56 176 16 LEU A 65 ? ? -91.55 -75.05 177 16 SER A 69 ? ? -136.71 -62.04 178 16 TRP A 72 ? ? 179.66 40.85 179 16 ASP A 75 ? ? -168.85 -66.47 180 17 SER A 19 ? ? -86.52 -145.77 181 17 ALA A 20 ? ? -171.61 33.87 182 17 SER A 43 ? ? -134.66 -71.02 183 17 TRP A 47 ? ? -106.65 -75.11 184 17 ASN A 58 ? ? -85.34 -94.58 185 17 CYS A 60 ? ? 82.97 86.59 186 17 PHE A 61 ? ? -128.91 -165.52 187 17 LEU A 65 ? ? -127.22 -51.28 188 17 SER A 69 ? ? -142.51 -54.74 189 17 LYS A 74 ? ? -160.98 30.28 190 18 ALA A 20 ? ? 86.35 49.21 191 18 ARG A 41 ? ? -99.39 30.65 192 18 SER A 43 ? ? -69.74 -77.56 193 18 THR A 45 ? ? -89.99 36.82 194 18 ASN A 58 ? ? -101.11 -77.47 195 18 CYS A 60 ? ? 94.76 71.03 196 18 PHE A 61 ? ? -125.76 -165.10 197 18 ARG A 66 ? ? 38.51 64.96 198 18 SER A 69 ? ? -153.73 -56.46 199 18 ASP A 75 ? ? 171.23 -69.80 200 19 SER A 19 ? ? -91.23 -143.95 201 19 ALA A 20 ? ? -171.05 33.98 202 19 TYR A 44 ? ? -163.02 107.50 203 19 ASN A 58 ? ? -103.24 -78.27 204 19 CYS A 60 ? ? 88.81 63.63 205 19 PHE A 61 ? ? -119.39 -167.00 206 19 LEU A 65 ? ? 60.28 177.76 207 19 SER A 69 ? ? -149.25 -46.40 208 19 PRO A 71 ? ? -74.94 49.71 209 19 LYS A 74 ? ? 75.93 39.52 210 20 ALA A 20 ? ? 92.82 38.92 211 20 SER A 43 ? ? -151.18 -72.26 212 20 TYR A 44 ? ? -168.58 105.66 213 20 CYS A 60 ? ? 86.37 72.30 214 20 PHE A 61 ? ? -125.99 -165.70 215 20 LEU A 65 ? ? -39.23 154.87 216 20 ARG A 66 ? ? -60.77 86.35 217 20 LYS A 74 ? ? -162.58 41.77 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A PRO 2 ? A PRO 1 2 1 Y 1 A LYS 3 ? A LYS 2 3 1 Y 1 A PRO 4 ? A PRO 3 4 1 Y 1 A PRO 5 ? A PRO 4 5 1 Y 1 A TYR 6 ? A TYR 5 6 1 Y 1 A SER 7 ? A SER 6 7 1 Y 1 A ASN 83 ? A ASN 82 8 1 Y 1 A SER 84 ? A SER 83 9 1 Y 1 A GLU 85 ? A GLU 84 10 1 Y 1 A TYR 86 ? A TYR 85 11 1 Y 1 A THR 87 ? A THR 86 12 1 Y 1 A PHE 88 ? A PHE 87 13 1 Y 1 A ALA 89 ? A ALA 88 14 1 Y 1 A ASP 90 ? A ASP 89 15 1 Y 1 A GLY 91 ? A GLY 90 16 1 Y 1 A VAL 92 ? A VAL 91 17 1 Y 1 A PHE 93 ? A PHE 92 18 1 Y 1 A ARG 94 ? A ARG 93 19 1 Y 1 A ARG 95 ? A ARG 94 20 1 Y 1 A ARG 96 ? A ARG 95 21 1 Y 1 A ARG 97 ? A ARG 96 22 1 Y 1 A TYR 98 ? A TYR 97 23 1 Y 1 A ARG 99 ? A ARG 98 24 1 Y 1 A LEU 100 ? A LEU 99 25 1 Y 1 A SER 101 ? A SER 100 26 2 Y 1 A PRO 2 ? A PRO 1 27 2 Y 1 A LYS 3 ? A LYS 2 28 2 Y 1 A PRO 4 ? A PRO 3 29 2 Y 1 A PRO 5 ? A PRO 4 30 2 Y 1 A TYR 6 ? A TYR 5 31 2 Y 1 A SER 7 ? A SER 6 32 2 Y 1 A ASN 83 ? A ASN 82 33 2 Y 1 A SER 84 ? A SER 83 34 2 Y 1 A GLU 85 ? A GLU 84 35 2 Y 1 A TYR 86 ? A TYR 85 36 2 Y 1 A THR 87 ? A THR 86 37 2 Y 1 A PHE 88 ? A PHE 87 38 2 Y 1 A ALA 89 ? A ALA 88 39 2 Y 1 A ASP 90 ? A ASP 89 40 2 Y 1 A GLY 91 ? A GLY 90 41 2 Y 1 A VAL 92 ? A VAL 91 42 2 Y 1 A PHE 93 ? A PHE 92 43 2 Y 1 A ARG 94 ? A ARG 93 44 2 Y 1 A ARG 95 ? A ARG 94 45 2 Y 1 A ARG 96 ? A ARG 95 46 2 Y 1 A ARG 97 ? A ARG 96 47 2 Y 1 A TYR 98 ? A TYR 97 48 2 Y 1 A ARG 99 ? A ARG 98 49 2 Y 1 A LEU 100 ? A LEU 99 50 2 Y 1 A SER 101 ? A SER 100 51 3 Y 1 A PRO 2 ? A PRO 1 52 3 Y 1 A LYS 3 ? A LYS 2 53 3 Y 1 A PRO 4 ? A PRO 3 54 3 Y 1 A PRO 5 ? A PRO 4 55 3 Y 1 A TYR 6 ? A TYR 5 56 3 Y 1 A SER 7 ? A SER 6 57 3 Y 1 A ASN 83 ? A ASN 82 58 3 Y 1 A SER 84 ? A SER 83 59 3 Y 1 A GLU 85 ? A GLU 84 60 3 Y 1 A TYR 86 ? A TYR 85 61 3 Y 1 A THR 87 ? A THR 86 62 3 Y 1 A PHE 88 ? A PHE 87 63 3 Y 1 A ALA 89 ? A ALA 88 64 3 Y 1 A ASP 90 ? A ASP 89 65 3 Y 1 A GLY 91 ? A GLY 90 66 3 Y 1 A VAL 92 ? A VAL 91 67 3 Y 1 A PHE 93 ? A PHE 92 68 3 Y 1 A ARG 94 ? A ARG 93 69 3 Y 1 A ARG 95 ? A ARG 94 70 3 Y 1 A ARG 96 ? A ARG 95 71 3 Y 1 A ARG 97 ? A ARG 96 72 3 Y 1 A TYR 98 ? A TYR 97 73 3 Y 1 A ARG 99 ? A ARG 98 74 3 Y 1 A LEU 100 ? A LEU 99 75 3 Y 1 A SER 101 ? A SER 100 76 4 Y 1 A PRO 2 ? A PRO 1 77 4 Y 1 A LYS 3 ? A LYS 2 78 4 Y 1 A PRO 4 ? A PRO 3 79 4 Y 1 A PRO 5 ? A PRO 4 80 4 Y 1 A TYR 6 ? A TYR 5 81 4 Y 1 A SER 7 ? A SER 6 82 4 Y 1 A ASN 83 ? A ASN 82 83 4 Y 1 A SER 84 ? A SER 83 84 4 Y 1 A GLU 85 ? A GLU 84 85 4 Y 1 A TYR 86 ? A TYR 85 86 4 Y 1 A THR 87 ? A THR 86 87 4 Y 1 A PHE 88 ? A PHE 87 88 4 Y 1 A ALA 89 ? A ALA 88 89 4 Y 1 A ASP 90 ? A ASP 89 90 4 Y 1 A GLY 91 ? A GLY 90 91 4 Y 1 A VAL 92 ? A VAL 91 92 4 Y 1 A PHE 93 ? A PHE 92 93 4 Y 1 A ARG 94 ? A ARG 93 94 4 Y 1 A ARG 95 ? A ARG 94 95 4 Y 1 A ARG 96 ? A ARG 95 96 4 Y 1 A ARG 97 ? A ARG 96 97 4 Y 1 A TYR 98 ? A TYR 97 98 4 Y 1 A ARG 99 ? A ARG 98 99 4 Y 1 A LEU 100 ? A LEU 99 100 4 Y 1 A SER 101 ? A SER 100 101 5 Y 1 A PRO 2 ? A PRO 1 102 5 Y 1 A LYS 3 ? A LYS 2 103 5 Y 1 A PRO 4 ? A PRO 3 104 5 Y 1 A PRO 5 ? A PRO 4 105 5 Y 1 A TYR 6 ? A TYR 5 106 5 Y 1 A SER 7 ? A SER 6 107 5 Y 1 A ASN 83 ? A ASN 82 108 5 Y 1 A SER 84 ? A SER 83 109 5 Y 1 A GLU 85 ? A GLU 84 110 5 Y 1 A TYR 86 ? A TYR 85 111 5 Y 1 A THR 87 ? A THR 86 112 5 Y 1 A PHE 88 ? A PHE 87 113 5 Y 1 A ALA 89 ? A ALA 88 114 5 Y 1 A ASP 90 ? A ASP 89 115 5 Y 1 A GLY 91 ? A GLY 90 116 5 Y 1 A VAL 92 ? A VAL 91 117 5 Y 1 A PHE 93 ? A PHE 92 118 5 Y 1 A ARG 94 ? A ARG 93 119 5 Y 1 A ARG 95 ? A ARG 94 120 5 Y 1 A ARG 96 ? A ARG 95 121 5 Y 1 A ARG 97 ? A ARG 96 122 5 Y 1 A TYR 98 ? A TYR 97 123 5 Y 1 A ARG 99 ? A ARG 98 124 5 Y 1 A LEU 100 ? A LEU 99 125 5 Y 1 A SER 101 ? A SER 100 126 6 Y 1 A PRO 2 ? A PRO 1 127 6 Y 1 A LYS 3 ? A LYS 2 128 6 Y 1 A PRO 4 ? A PRO 3 129 6 Y 1 A PRO 5 ? A PRO 4 130 6 Y 1 A TYR 6 ? A TYR 5 131 6 Y 1 A SER 7 ? A SER 6 132 6 Y 1 A ASN 83 ? A ASN 82 133 6 Y 1 A SER 84 ? A SER 83 134 6 Y 1 A GLU 85 ? A GLU 84 135 6 Y 1 A TYR 86 ? A TYR 85 136 6 Y 1 A THR 87 ? A THR 86 137 6 Y 1 A PHE 88 ? A PHE 87 138 6 Y 1 A ALA 89 ? A ALA 88 139 6 Y 1 A ASP 90 ? A ASP 89 140 6 Y 1 A GLY 91 ? A GLY 90 141 6 Y 1 A VAL 92 ? A VAL 91 142 6 Y 1 A PHE 93 ? A PHE 92 143 6 Y 1 A ARG 94 ? A ARG 93 144 6 Y 1 A ARG 95 ? A ARG 94 145 6 Y 1 A ARG 96 ? A ARG 95 146 6 Y 1 A ARG 97 ? A ARG 96 147 6 Y 1 A TYR 98 ? A TYR 97 148 6 Y 1 A ARG 99 ? A ARG 98 149 6 Y 1 A LEU 100 ? A LEU 99 150 6 Y 1 A SER 101 ? A SER 100 151 7 Y 1 A PRO 2 ? A PRO 1 152 7 Y 1 A LYS 3 ? A LYS 2 153 7 Y 1 A PRO 4 ? A PRO 3 154 7 Y 1 A PRO 5 ? A PRO 4 155 7 Y 1 A TYR 6 ? A TYR 5 156 7 Y 1 A SER 7 ? A SER 6 157 7 Y 1 A ASN 83 ? A ASN 82 158 7 Y 1 A SER 84 ? A SER 83 159 7 Y 1 A GLU 85 ? A GLU 84 160 7 Y 1 A TYR 86 ? A TYR 85 161 7 Y 1 A THR 87 ? A THR 86 162 7 Y 1 A PHE 88 ? A PHE 87 163 7 Y 1 A ALA 89 ? A ALA 88 164 7 Y 1 A ASP 90 ? A ASP 89 165 7 Y 1 A GLY 91 ? A GLY 90 166 7 Y 1 A VAL 92 ? A VAL 91 167 7 Y 1 A PHE 93 ? A PHE 92 168 7 Y 1 A ARG 94 ? A ARG 93 169 7 Y 1 A ARG 95 ? A ARG 94 170 7 Y 1 A ARG 96 ? A ARG 95 171 7 Y 1 A ARG 97 ? A ARG 96 172 7 Y 1 A TYR 98 ? A TYR 97 173 7 Y 1 A ARG 99 ? A ARG 98 174 7 Y 1 A LEU 100 ? A LEU 99 175 7 Y 1 A SER 101 ? A SER 100 176 8 Y 1 A PRO 2 ? A PRO 1 177 8 Y 1 A LYS 3 ? A LYS 2 178 8 Y 1 A PRO 4 ? A PRO 3 179 8 Y 1 A PRO 5 ? A PRO 4 180 8 Y 1 A TYR 6 ? A TYR 5 181 8 Y 1 A SER 7 ? A SER 6 182 8 Y 1 A ASN 83 ? A ASN 82 183 8 Y 1 A SER 84 ? A SER 83 184 8 Y 1 A GLU 85 ? A GLU 84 185 8 Y 1 A TYR 86 ? A TYR 85 186 8 Y 1 A THR 87 ? A THR 86 187 8 Y 1 A PHE 88 ? A PHE 87 188 8 Y 1 A ALA 89 ? A ALA 88 189 8 Y 1 A ASP 90 ? A ASP 89 190 8 Y 1 A GLY 91 ? A GLY 90 191 8 Y 1 A VAL 92 ? A VAL 91 192 8 Y 1 A PHE 93 ? A PHE 92 193 8 Y 1 A ARG 94 ? A ARG 93 194 8 Y 1 A ARG 95 ? A ARG 94 195 8 Y 1 A ARG 96 ? A ARG 95 196 8 Y 1 A ARG 97 ? A ARG 96 197 8 Y 1 A TYR 98 ? A TYR 97 198 8 Y 1 A ARG 99 ? A ARG 98 199 8 Y 1 A LEU 100 ? A LEU 99 200 8 Y 1 A SER 101 ? A SER 100 201 9 Y 1 A PRO 2 ? A PRO 1 202 9 Y 1 A LYS 3 ? A LYS 2 203 9 Y 1 A PRO 4 ? A PRO 3 204 9 Y 1 A PRO 5 ? A PRO 4 205 9 Y 1 A TYR 6 ? A TYR 5 206 9 Y 1 A SER 7 ? A SER 6 207 9 Y 1 A ASN 83 ? A ASN 82 208 9 Y 1 A SER 84 ? A SER 83 209 9 Y 1 A GLU 85 ? A GLU 84 210 9 Y 1 A TYR 86 ? A TYR 85 211 9 Y 1 A THR 87 ? A THR 86 212 9 Y 1 A PHE 88 ? A PHE 87 213 9 Y 1 A ALA 89 ? A ALA 88 214 9 Y 1 A ASP 90 ? A ASP 89 215 9 Y 1 A GLY 91 ? A GLY 90 216 9 Y 1 A VAL 92 ? A VAL 91 217 9 Y 1 A PHE 93 ? A PHE 92 218 9 Y 1 A ARG 94 ? A ARG 93 219 9 Y 1 A ARG 95 ? A ARG 94 220 9 Y 1 A ARG 96 ? A ARG 95 221 9 Y 1 A ARG 97 ? A ARG 96 222 9 Y 1 A TYR 98 ? A TYR 97 223 9 Y 1 A ARG 99 ? A ARG 98 224 9 Y 1 A LEU 100 ? A LEU 99 225 9 Y 1 A SER 101 ? A SER 100 226 10 Y 1 A PRO 2 ? A PRO 1 227 10 Y 1 A LYS 3 ? A LYS 2 228 10 Y 1 A PRO 4 ? A PRO 3 229 10 Y 1 A PRO 5 ? A PRO 4 230 10 Y 1 A TYR 6 ? A TYR 5 231 10 Y 1 A SER 7 ? A SER 6 232 10 Y 1 A ASN 83 ? A ASN 82 233 10 Y 1 A SER 84 ? A SER 83 234 10 Y 1 A GLU 85 ? A GLU 84 235 10 Y 1 A TYR 86 ? A TYR 85 236 10 Y 1 A THR 87 ? A THR 86 237 10 Y 1 A PHE 88 ? A PHE 87 238 10 Y 1 A ALA 89 ? A ALA 88 239 10 Y 1 A ASP 90 ? A ASP 89 240 10 Y 1 A GLY 91 ? A GLY 90 241 10 Y 1 A VAL 92 ? A VAL 91 242 10 Y 1 A PHE 93 ? A PHE 92 243 10 Y 1 A ARG 94 ? A ARG 93 244 10 Y 1 A ARG 95 ? A ARG 94 245 10 Y 1 A ARG 96 ? A ARG 95 246 10 Y 1 A ARG 97 ? A ARG 96 247 10 Y 1 A TYR 98 ? A TYR 97 248 10 Y 1 A ARG 99 ? A ARG 98 249 10 Y 1 A LEU 100 ? A LEU 99 250 10 Y 1 A SER 101 ? A SER 100 251 11 Y 1 A PRO 2 ? A PRO 1 252 11 Y 1 A LYS 3 ? A LYS 2 253 11 Y 1 A PRO 4 ? A PRO 3 254 11 Y 1 A PRO 5 ? A PRO 4 255 11 Y 1 A TYR 6 ? A TYR 5 256 11 Y 1 A SER 7 ? A SER 6 257 11 Y 1 A ASN 83 ? A ASN 82 258 11 Y 1 A SER 84 ? A SER 83 259 11 Y 1 A GLU 85 ? A GLU 84 260 11 Y 1 A TYR 86 ? A TYR 85 261 11 Y 1 A THR 87 ? A THR 86 262 11 Y 1 A PHE 88 ? A PHE 87 263 11 Y 1 A ALA 89 ? A ALA 88 264 11 Y 1 A ASP 90 ? A ASP 89 265 11 Y 1 A GLY 91 ? A GLY 90 266 11 Y 1 A VAL 92 ? A VAL 91 267 11 Y 1 A PHE 93 ? A PHE 92 268 11 Y 1 A ARG 94 ? A ARG 93 269 11 Y 1 A ARG 95 ? A ARG 94 270 11 Y 1 A ARG 96 ? A ARG 95 271 11 Y 1 A ARG 97 ? A ARG 96 272 11 Y 1 A TYR 98 ? A TYR 97 273 11 Y 1 A ARG 99 ? A ARG 98 274 11 Y 1 A LEU 100 ? A LEU 99 275 11 Y 1 A SER 101 ? A SER 100 276 12 Y 1 A PRO 2 ? A PRO 1 277 12 Y 1 A LYS 3 ? A LYS 2 278 12 Y 1 A PRO 4 ? A PRO 3 279 12 Y 1 A PRO 5 ? A PRO 4 280 12 Y 1 A TYR 6 ? A TYR 5 281 12 Y 1 A SER 7 ? A SER 6 282 12 Y 1 A ASN 83 ? A ASN 82 283 12 Y 1 A SER 84 ? A SER 83 284 12 Y 1 A GLU 85 ? A GLU 84 285 12 Y 1 A TYR 86 ? A TYR 85 286 12 Y 1 A THR 87 ? A THR 86 287 12 Y 1 A PHE 88 ? A PHE 87 288 12 Y 1 A ALA 89 ? A ALA 88 289 12 Y 1 A ASP 90 ? A ASP 89 290 12 Y 1 A GLY 91 ? A GLY 90 291 12 Y 1 A VAL 92 ? A VAL 91 292 12 Y 1 A PHE 93 ? A PHE 92 293 12 Y 1 A ARG 94 ? A ARG 93 294 12 Y 1 A ARG 95 ? A ARG 94 295 12 Y 1 A ARG 96 ? A ARG 95 296 12 Y 1 A ARG 97 ? A ARG 96 297 12 Y 1 A TYR 98 ? A TYR 97 298 12 Y 1 A ARG 99 ? A ARG 98 299 12 Y 1 A LEU 100 ? A LEU 99 300 12 Y 1 A SER 101 ? A SER 100 301 13 Y 1 A PRO 2 ? A PRO 1 302 13 Y 1 A LYS 3 ? A LYS 2 303 13 Y 1 A PRO 4 ? A PRO 3 304 13 Y 1 A PRO 5 ? A PRO 4 305 13 Y 1 A TYR 6 ? A TYR 5 306 13 Y 1 A SER 7 ? A SER 6 307 13 Y 1 A ASN 83 ? A ASN 82 308 13 Y 1 A SER 84 ? A SER 83 309 13 Y 1 A GLU 85 ? A GLU 84 310 13 Y 1 A TYR 86 ? A TYR 85 311 13 Y 1 A THR 87 ? A THR 86 312 13 Y 1 A PHE 88 ? A PHE 87 313 13 Y 1 A ALA 89 ? A ALA 88 314 13 Y 1 A ASP 90 ? A ASP 89 315 13 Y 1 A GLY 91 ? A GLY 90 316 13 Y 1 A VAL 92 ? A VAL 91 317 13 Y 1 A PHE 93 ? A PHE 92 318 13 Y 1 A ARG 94 ? A ARG 93 319 13 Y 1 A ARG 95 ? A ARG 94 320 13 Y 1 A ARG 96 ? A ARG 95 321 13 Y 1 A ARG 97 ? A ARG 96 322 13 Y 1 A TYR 98 ? A TYR 97 323 13 Y 1 A ARG 99 ? A ARG 98 324 13 Y 1 A LEU 100 ? A LEU 99 325 13 Y 1 A SER 101 ? A SER 100 326 14 Y 1 A PRO 2 ? A PRO 1 327 14 Y 1 A LYS 3 ? A LYS 2 328 14 Y 1 A PRO 4 ? A PRO 3 329 14 Y 1 A PRO 5 ? A PRO 4 330 14 Y 1 A TYR 6 ? A TYR 5 331 14 Y 1 A SER 7 ? A SER 6 332 14 Y 1 A ASN 83 ? A ASN 82 333 14 Y 1 A SER 84 ? A SER 83 334 14 Y 1 A GLU 85 ? A GLU 84 335 14 Y 1 A TYR 86 ? A TYR 85 336 14 Y 1 A THR 87 ? A THR 86 337 14 Y 1 A PHE 88 ? A PHE 87 338 14 Y 1 A ALA 89 ? A ALA 88 339 14 Y 1 A ASP 90 ? A ASP 89 340 14 Y 1 A GLY 91 ? A GLY 90 341 14 Y 1 A VAL 92 ? A VAL 91 342 14 Y 1 A PHE 93 ? A PHE 92 343 14 Y 1 A ARG 94 ? A ARG 93 344 14 Y 1 A ARG 95 ? A ARG 94 345 14 Y 1 A ARG 96 ? A ARG 95 346 14 Y 1 A ARG 97 ? A ARG 96 347 14 Y 1 A TYR 98 ? A TYR 97 348 14 Y 1 A ARG 99 ? A ARG 98 349 14 Y 1 A LEU 100 ? A LEU 99 350 14 Y 1 A SER 101 ? A SER 100 351 15 Y 1 A PRO 2 ? A PRO 1 352 15 Y 1 A LYS 3 ? A LYS 2 353 15 Y 1 A PRO 4 ? A PRO 3 354 15 Y 1 A PRO 5 ? A PRO 4 355 15 Y 1 A TYR 6 ? A TYR 5 356 15 Y 1 A SER 7 ? A SER 6 357 15 Y 1 A ASN 83 ? A ASN 82 358 15 Y 1 A SER 84 ? A SER 83 359 15 Y 1 A GLU 85 ? A GLU 84 360 15 Y 1 A TYR 86 ? A TYR 85 361 15 Y 1 A THR 87 ? A THR 86 362 15 Y 1 A PHE 88 ? A PHE 87 363 15 Y 1 A ALA 89 ? A ALA 88 364 15 Y 1 A ASP 90 ? A ASP 89 365 15 Y 1 A GLY 91 ? A GLY 90 366 15 Y 1 A VAL 92 ? A VAL 91 367 15 Y 1 A PHE 93 ? A PHE 92 368 15 Y 1 A ARG 94 ? A ARG 93 369 15 Y 1 A ARG 95 ? A ARG 94 370 15 Y 1 A ARG 96 ? A ARG 95 371 15 Y 1 A ARG 97 ? A ARG 96 372 15 Y 1 A TYR 98 ? A TYR 97 373 15 Y 1 A ARG 99 ? A ARG 98 374 15 Y 1 A LEU 100 ? A LEU 99 375 15 Y 1 A SER 101 ? A SER 100 376 16 Y 1 A PRO 2 ? A PRO 1 377 16 Y 1 A LYS 3 ? A LYS 2 378 16 Y 1 A PRO 4 ? A PRO 3 379 16 Y 1 A PRO 5 ? A PRO 4 380 16 Y 1 A TYR 6 ? A TYR 5 381 16 Y 1 A SER 7 ? A SER 6 382 16 Y 1 A ASN 83 ? A ASN 82 383 16 Y 1 A SER 84 ? A SER 83 384 16 Y 1 A GLU 85 ? A GLU 84 385 16 Y 1 A TYR 86 ? A TYR 85 386 16 Y 1 A THR 87 ? A THR 86 387 16 Y 1 A PHE 88 ? A PHE 87 388 16 Y 1 A ALA 89 ? A ALA 88 389 16 Y 1 A ASP 90 ? A ASP 89 390 16 Y 1 A GLY 91 ? A GLY 90 391 16 Y 1 A VAL 92 ? A VAL 91 392 16 Y 1 A PHE 93 ? A PHE 92 393 16 Y 1 A ARG 94 ? A ARG 93 394 16 Y 1 A ARG 95 ? A ARG 94 395 16 Y 1 A ARG 96 ? A ARG 95 396 16 Y 1 A ARG 97 ? A ARG 96 397 16 Y 1 A TYR 98 ? A TYR 97 398 16 Y 1 A ARG 99 ? A ARG 98 399 16 Y 1 A LEU 100 ? A LEU 99 400 16 Y 1 A SER 101 ? A SER 100 401 17 Y 1 A PRO 2 ? A PRO 1 402 17 Y 1 A LYS 3 ? A LYS 2 403 17 Y 1 A PRO 4 ? A PRO 3 404 17 Y 1 A PRO 5 ? A PRO 4 405 17 Y 1 A TYR 6 ? A TYR 5 406 17 Y 1 A SER 7 ? A SER 6 407 17 Y 1 A ASN 83 ? A ASN 82 408 17 Y 1 A SER 84 ? A SER 83 409 17 Y 1 A GLU 85 ? A GLU 84 410 17 Y 1 A TYR 86 ? A TYR 85 411 17 Y 1 A THR 87 ? A THR 86 412 17 Y 1 A PHE 88 ? A PHE 87 413 17 Y 1 A ALA 89 ? A ALA 88 414 17 Y 1 A ASP 90 ? A ASP 89 415 17 Y 1 A GLY 91 ? A GLY 90 416 17 Y 1 A VAL 92 ? A VAL 91 417 17 Y 1 A PHE 93 ? A PHE 92 418 17 Y 1 A ARG 94 ? A ARG 93 419 17 Y 1 A ARG 95 ? A ARG 94 420 17 Y 1 A ARG 96 ? A ARG 95 421 17 Y 1 A ARG 97 ? A ARG 96 422 17 Y 1 A TYR 98 ? A TYR 97 423 17 Y 1 A ARG 99 ? A ARG 98 424 17 Y 1 A LEU 100 ? A LEU 99 425 17 Y 1 A SER 101 ? A SER 100 426 18 Y 1 A PRO 2 ? A PRO 1 427 18 Y 1 A LYS 3 ? A LYS 2 428 18 Y 1 A PRO 4 ? A PRO 3 429 18 Y 1 A PRO 5 ? A PRO 4 430 18 Y 1 A TYR 6 ? A TYR 5 431 18 Y 1 A SER 7 ? A SER 6 432 18 Y 1 A ASN 83 ? A ASN 82 433 18 Y 1 A SER 84 ? A SER 83 434 18 Y 1 A GLU 85 ? A GLU 84 435 18 Y 1 A TYR 86 ? A TYR 85 436 18 Y 1 A THR 87 ? A THR 86 437 18 Y 1 A PHE 88 ? A PHE 87 438 18 Y 1 A ALA 89 ? A ALA 88 439 18 Y 1 A ASP 90 ? A ASP 89 440 18 Y 1 A GLY 91 ? A GLY 90 441 18 Y 1 A VAL 92 ? A VAL 91 442 18 Y 1 A PHE 93 ? A PHE 92 443 18 Y 1 A ARG 94 ? A ARG 93 444 18 Y 1 A ARG 95 ? A ARG 94 445 18 Y 1 A ARG 96 ? A ARG 95 446 18 Y 1 A ARG 97 ? A ARG 96 447 18 Y 1 A TYR 98 ? A TYR 97 448 18 Y 1 A ARG 99 ? A ARG 98 449 18 Y 1 A LEU 100 ? A LEU 99 450 18 Y 1 A SER 101 ? A SER 100 451 19 Y 1 A PRO 2 ? A PRO 1 452 19 Y 1 A LYS 3 ? A LYS 2 453 19 Y 1 A PRO 4 ? A PRO 3 454 19 Y 1 A PRO 5 ? A PRO 4 455 19 Y 1 A TYR 6 ? A TYR 5 456 19 Y 1 A SER 7 ? A SER 6 457 19 Y 1 A ASN 83 ? A ASN 82 458 19 Y 1 A SER 84 ? A SER 83 459 19 Y 1 A GLU 85 ? A GLU 84 460 19 Y 1 A TYR 86 ? A TYR 85 461 19 Y 1 A THR 87 ? A THR 86 462 19 Y 1 A PHE 88 ? A PHE 87 463 19 Y 1 A ALA 89 ? A ALA 88 464 19 Y 1 A ASP 90 ? A ASP 89 465 19 Y 1 A GLY 91 ? A GLY 90 466 19 Y 1 A VAL 92 ? A VAL 91 467 19 Y 1 A PHE 93 ? A PHE 92 468 19 Y 1 A ARG 94 ? A ARG 93 469 19 Y 1 A ARG 95 ? A ARG 94 470 19 Y 1 A ARG 96 ? A ARG 95 471 19 Y 1 A ARG 97 ? A ARG 96 472 19 Y 1 A TYR 98 ? A TYR 97 473 19 Y 1 A ARG 99 ? A ARG 98 474 19 Y 1 A LEU 100 ? A LEU 99 475 19 Y 1 A SER 101 ? A SER 100 476 20 Y 1 A PRO 2 ? A PRO 1 477 20 Y 1 A LYS 3 ? A LYS 2 478 20 Y 1 A PRO 4 ? A PRO 3 479 20 Y 1 A PRO 5 ? A PRO 4 480 20 Y 1 A TYR 6 ? A TYR 5 481 20 Y 1 A SER 7 ? A SER 6 482 20 Y 1 A ASN 83 ? A ASN 82 483 20 Y 1 A SER 84 ? A SER 83 484 20 Y 1 A GLU 85 ? A GLU 84 485 20 Y 1 A TYR 86 ? A TYR 85 486 20 Y 1 A THR 87 ? A THR 86 487 20 Y 1 A PHE 88 ? A PHE 87 488 20 Y 1 A ALA 89 ? A ALA 88 489 20 Y 1 A ASP 90 ? A ASP 89 490 20 Y 1 A GLY 91 ? A GLY 90 491 20 Y 1 A VAL 92 ? A VAL 91 492 20 Y 1 A PHE 93 ? A PHE 92 493 20 Y 1 A ARG 94 ? A ARG 93 494 20 Y 1 A ARG 95 ? A ARG 94 495 20 Y 1 A ARG 96 ? A ARG 95 496 20 Y 1 A ARG 97 ? A ARG 96 497 20 Y 1 A TYR 98 ? A TYR 97 498 20 Y 1 A ARG 99 ? A ARG 98 499 20 Y 1 A LEU 100 ? A LEU 99 500 20 Y 1 A SER 101 ? A SER 100 #