data_1KQL # _entry.id 1KQL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KQL pdb_00001kql 10.2210/pdb1kql/pdb RCSB RCSB015236 ? ? WWPDB D_1000015236 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-05-29 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-07-26 5 'Structure model' 1 4 2022-12-21 6 'Structure model' 1 5 2024-03-13 7 'Structure model' 1 6 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Refinement description' 4 4 'Structure model' 'Source and taxonomy' 5 5 'Structure model' 'Database references' 6 6 'Structure model' 'Data collection' 7 6 'Structure model' 'Source and taxonomy' 8 7 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' software 3 5 'Structure model' database_2 4 5 'Structure model' struct_ref_seq_dif 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' entity_src_gen 8 7 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KQL _pdbx_database_status.recvd_initial_deposition_date 2002-01-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Y.' 1 'Mui, S.' 2 'Brown, J.H.' 3 'Strand, J.' 4 'Reshetnikova, L.' 5 'Tobacman, L.S.' 6 'Cohen, C.' 7 # _citation.id primary _citation.title 'The crystal structure of the C-terminal fragment of striated-muscle alpha-tropomyosin reveals a key troponin T recognition site.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 99 _citation.page_first 7378 _citation.page_last 7383 _citation.year 2002 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12032291 _citation.pdbx_database_id_DOI 10.1073/pnas.102179999 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Y.' 1 ? primary 'Mui, S.' 2 ? primary 'Brown, J.H.' 3 ? primary 'Strand, J.' 4 ? primary 'Reshetnikova, L.' 5 ? primary 'Tobacman, L.S.' 6 ? primary 'Cohen, C.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fusion Protein of and striated muscle alpha-tropomyosin and the GCN4 leucine zipper' 6603.480 2 ? ? ? ;N-terminal methionine followed by sequence database residues 255-278 of GCN4 leucine zipper and then C-terminal sequence database residues 254-284 of rat striated muscle alpha-tropomyosin ; 2 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI _entity_poly.pdbx_seq_one_letter_code_can MDKVEELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMTSI _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 VAL n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 LEU n 1 9 SER n 1 10 LYS n 1 11 ASN n 1 12 TYR n 1 13 HIS n 1 14 LEU n 1 15 GLU n 1 16 ASN n 1 17 GLU n 1 18 VAL n 1 19 ALA n 1 20 ARG n 1 21 LEU n 1 22 LYS n 1 23 LYS n 1 24 LEU n 1 25 VAL n 1 26 ASP n 1 27 ASP n 1 28 LEU n 1 29 GLU n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 TYR n 1 34 ALA n 1 35 GLN n 1 36 LYS n 1 37 LEU n 1 38 LYS n 1 39 TYR n 1 40 LYS n 1 41 ALA n 1 42 ILE n 1 43 SER n 1 44 GLU n 1 45 GLU n 1 46 LEU n 1 47 ASP n 1 48 HIS n 1 49 ALA n 1 50 LEU n 1 51 ASN n 1 52 ASP n 1 53 MET n 1 54 THR n 1 55 SER n 1 56 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? 2 25 ;baker's yeast, Norway rat ; 'Saccharomyces, Rattus' ? , , ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia 'GCN4, ARG9' ? ? ? ? DE3 ? ? ? ? ? ? ? plasmid ? ? ? pET3d ? ? 1 2 sample ? 26 56 ;baker's yeast, Norway rat ; 'Saccharomyces, Rattus' ? , , ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia 'GCN4, ARG9' ? ? ? ? DE3 ? ? ? ? ? ? ? plasmid ? ? ? pET3d ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 229 229 MET MET A . n A 1 2 ASP 2 230 230 ASP ASP A . n A 1 3 LYS 3 231 231 LYS LYS A . n A 1 4 VAL 4 232 232 VAL VAL A . n A 1 5 GLU 5 233 233 GLU GLU A . n A 1 6 GLU 6 234 234 GLU GLU A . n A 1 7 LEU 7 235 235 LEU LEU A . n A 1 8 LEU 8 236 236 LEU LEU A . n A 1 9 SER 9 237 237 SER SER A . n A 1 10 LYS 10 238 238 LYS LYS A . n A 1 11 ASN 11 239 239 ASN ASN A . n A 1 12 TYR 12 240 240 TYR TYR A . n A 1 13 HIS 13 241 241 HIS HIS A . n A 1 14 LEU 14 242 242 LEU LEU A . n A 1 15 GLU 15 243 243 GLU GLU A . n A 1 16 ASN 16 244 244 ASN ASN A . n A 1 17 GLU 17 245 245 GLU GLU A . n A 1 18 VAL 18 246 246 VAL VAL A . n A 1 19 ALA 19 247 247 ALA ALA A . n A 1 20 ARG 20 248 248 ARG ARG A . n A 1 21 LEU 21 249 249 LEU LEU A . n A 1 22 LYS 22 250 250 LYS LYS A . n A 1 23 LYS 23 251 251 LYS LYS A . n A 1 24 LEU 24 252 252 LEU LEU A . n A 1 25 VAL 25 253 253 VAL VAL A . n A 1 26 ASP 26 254 254 ASP ASP A . n A 1 27 ASP 27 255 255 ASP ASP A . n A 1 28 LEU 28 256 256 LEU LEU A . n A 1 29 GLU 29 257 257 GLU GLU A . n A 1 30 ASP 30 258 258 ASP ASP A . n A 1 31 GLU 31 259 259 GLU GLU A . n A 1 32 LEU 32 260 260 LEU LEU A . n A 1 33 TYR 33 261 261 TYR TYR A . n A 1 34 ALA 34 262 262 ALA ALA A . n A 1 35 GLN 35 263 263 GLN GLN A . n A 1 36 LYS 36 264 264 LYS LYS A . n A 1 37 LEU 37 265 265 LEU LEU A . n A 1 38 LYS 38 266 266 LYS LYS A . n A 1 39 TYR 39 267 267 TYR TYR A . n A 1 40 LYS 40 268 268 LYS LYS A . n A 1 41 ALA 41 269 269 ALA ALA A . n A 1 42 ILE 42 270 270 ILE ILE A . n A 1 43 SER 43 271 271 SER SER A . n A 1 44 GLU 44 272 272 GLU GLU A . n A 1 45 GLU 45 273 273 GLU GLU A . n A 1 46 LEU 46 274 274 LEU LEU A . n A 1 47 ASP 47 275 275 ASP ASP A . n A 1 48 HIS 48 276 276 HIS HIS A . n A 1 49 ALA 49 277 277 ALA ALA A . n A 1 50 LEU 50 278 278 LEU LEU A . n A 1 51 ASN 51 279 279 ASN ASN A . n A 1 52 ASP 52 280 280 ASP ASP A . n A 1 53 MET 53 281 281 MET MET A . n A 1 54 THR 54 282 282 THR THR A . n A 1 55 SER 55 283 283 SER SER A . n A 1 56 ILE 56 284 ? ? ? A . n B 1 1 MET 1 229 229 MET MET B . n B 1 2 ASP 2 230 230 ASP ASP B . n B 1 3 LYS 3 231 231 LYS LYS B . n B 1 4 VAL 4 232 232 VAL VAL B . n B 1 5 GLU 5 233 233 GLU GLU B . n B 1 6 GLU 6 234 234 GLU GLU B . n B 1 7 LEU 7 235 235 LEU LEU B . n B 1 8 LEU 8 236 236 LEU LEU B . n B 1 9 SER 9 237 237 SER SER B . n B 1 10 LYS 10 238 238 LYS LYS B . n B 1 11 ASN 11 239 239 ASN ASN B . n B 1 12 TYR 12 240 240 TYR TYR B . n B 1 13 HIS 13 241 241 HIS HIS B . n B 1 14 LEU 14 242 242 LEU LEU B . n B 1 15 GLU 15 243 243 GLU GLU B . n B 1 16 ASN 16 244 244 ASN ASN B . n B 1 17 GLU 17 245 245 GLU GLU B . n B 1 18 VAL 18 246 246 VAL VAL B . n B 1 19 ALA 19 247 247 ALA ALA B . n B 1 20 ARG 20 248 248 ARG ARG B . n B 1 21 LEU 21 249 249 LEU LEU B . n B 1 22 LYS 22 250 250 LYS LYS B . n B 1 23 LYS 23 251 251 LYS LYS B . n B 1 24 LEU 24 252 252 LEU LEU B . n B 1 25 VAL 25 253 253 VAL VAL B . n B 1 26 ASP 26 254 254 ASP ASP B . n B 1 27 ASP 27 255 255 ASP ASP B . n B 1 28 LEU 28 256 256 LEU LEU B . n B 1 29 GLU 29 257 257 GLU GLU B . n B 1 30 ASP 30 258 258 ASP ASP B . n B 1 31 GLU 31 259 259 GLU GLU B . n B 1 32 LEU 32 260 260 LEU LEU B . n B 1 33 TYR 33 261 261 TYR TYR B . n B 1 34 ALA 34 262 262 ALA ALA B . n B 1 35 GLN 35 263 263 GLN GLN B . n B 1 36 LYS 36 264 264 LYS LYS B . n B 1 37 LEU 37 265 265 LEU LEU B . n B 1 38 LYS 38 266 266 LYS LYS B . n B 1 39 TYR 39 267 267 TYR TYR B . n B 1 40 LYS 40 268 268 LYS LYS B . n B 1 41 ALA 41 269 269 ALA ALA B . n B 1 42 ILE 42 270 270 ILE ILE B . n B 1 43 SER 43 271 271 SER SER B . n B 1 44 GLU 44 272 272 GLU GLU B . n B 1 45 GLU 45 273 273 GLU GLU B . n B 1 46 LEU 46 274 274 LEU LEU B . n B 1 47 ASP 47 275 275 ASP ASP B . n B 1 48 HIS 48 276 276 HIS HIS B . n B 1 49 ALA 49 277 277 ALA ALA B . n B 1 50 LEU 50 278 278 LEU LEU B . n B 1 51 ASN 51 279 279 ASN ASN B . n B 1 52 ASP 52 280 280 ASP ASP B . n B 1 53 MET 53 281 281 MET MET B . n B 1 54 THR 54 282 282 THR THR B . n B 1 55 SER 55 283 ? ? ? B . n B 1 56 ILE 56 284 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 HOH 1 2 2 HOH HOH A . C 2 HOH 2 5 5 HOH HOH A . C 2 HOH 3 8 8 HOH HOH A . C 2 HOH 4 9 9 HOH HOH A . C 2 HOH 5 11 11 HOH HOH A . C 2 HOH 6 12 12 HOH HOH A . C 2 HOH 7 13 13 HOH HOH A . C 2 HOH 8 19 19 HOH HOH A . C 2 HOH 9 22 22 HOH HOH A . C 2 HOH 10 24 24 HOH HOH A . C 2 HOH 11 25 25 HOH HOH A . C 2 HOH 12 27 27 HOH HOH A . D 2 HOH 1 1 1 HOH HOH B . D 2 HOH 2 3 3 HOH HOH B . D 2 HOH 3 4 4 HOH HOH B . D 2 HOH 4 6 6 HOH HOH B . D 2 HOH 5 7 7 HOH HOH B . D 2 HOH 6 10 10 HOH HOH B . D 2 HOH 7 14 14 HOH HOH B . D 2 HOH 8 15 15 HOH HOH B . D 2 HOH 9 16 16 HOH HOH B . D 2 HOH 10 17 17 HOH HOH B . D 2 HOH 11 18 18 HOH HOH B . D 2 HOH 12 20 20 HOH HOH B . D 2 HOH 13 21 21 HOH HOH B . D 2 HOH 14 23 23 HOH HOH B . D 2 HOH 15 26 26 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MET 229 ? CB ? A MET 1 CB 2 1 Y 1 A MET 229 ? CG ? A MET 1 CG 3 1 Y 1 A MET 229 ? SD ? A MET 1 SD 4 1 Y 1 A MET 229 ? CE ? A MET 1 CE 5 1 Y 1 B MET 229 ? CB ? B MET 1 CB 6 1 Y 1 B MET 229 ? CG ? B MET 1 CG 7 1 Y 1 B MET 229 ? SD ? B MET 1 SD 8 1 Y 1 B MET 229 ? CE ? B MET 1 CE # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal AMoRE phasing . ? 1 CNS refinement 1.0 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _cell.entry_id 1KQL _cell.length_a 137.202 _cell.length_b 137.202 _cell.length_c 40.071 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KQL _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 # _exptl.entry_id 1KQL _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 70 _exptl_crystal.density_Matthews 4.12 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.pdbx_details ;PEG 550 monomethylether, glycerol, sodium chloride, magnesium acetate, bicine, tris buffer, dithiothreitol, pH 8.3, VAPOR DIFFUSION, SITTING DROP, temperature 295K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-04-20 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator GRAPHITE _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.909 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.909 # _reflns.entry_id 1KQL _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.6 _reflns.number_obs 7221 _reflns.number_all 7229 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.0520000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 34.9 _reflns.B_iso_Wilson_estimate 82.3 _reflns.pdbx_redundancy 12.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.69 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.2170000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 9.14 _reflns_shell.pdbx_redundancy 8.2 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 708 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1KQL _refine.ls_number_reflns_obs 6469 _refine.ls_number_reflns_all 6469 _refine.pdbx_ls_sigma_I 0.0 _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 44.91 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 99.6 _refine.ls_R_factor_obs 0.2551000 _refine.ls_R_factor_all 0.2551000 _refine.ls_R_factor_R_work 0.2523000 _refine.ls_R_factor_R_free 0.2889000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 508 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 93.4 _refine.aniso_B[1][1] 2.22 _refine.aniso_B[2][2] 2.22 _refine.aniso_B[3][3] -4.43 _refine.aniso_B[1][2] 15.96 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ;a specially built 56-residue two-stranded coiled-coil that contains a 24 residue fragment from the high resolution structure of the GCN4 leucine zipper ; _refine.pdbx_method_to_determine_struct 'Molecular replacement using a specially built model' _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1KQL _refine_analyze.Luzzati_coordinate_error_obs 0.40 _refine_analyze.Luzzati_sigma_a_obs 0.37 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.48 _refine_analyze.Luzzati_sigma_a_free 0.41 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 892 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 919 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 44.91 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.0 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 15.6 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.64 ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_all _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_all 10 2.70 2.80 568 0.3295000 . 0.3353000 0.040 . 49 617 . . 'X-RAY DIFFRACTION' . 10 2.80 2.91 . 0.3134000 . 0.3547000 . . 45 621 . . 'X-RAY DIFFRACTION' . 10 2.91 3.04 . 0.2986000 . 0.3658000 . . 53 636 . . 'X-RAY DIFFRACTION' . 10 3.04 3.20 . 0.2696000 . 0.3673000 . . 49 628 . . 'X-RAY DIFFRACTION' . 10 3.20 3.40 . 0.2628000 . 0.2770000 . . 50 636 . . 'X-RAY DIFFRACTION' . 10 3.40 3.66 . 0.2970000 . 0.2816000 . . 60 644 . . 'X-RAY DIFFRACTION' . # _database_PDB_matrix.entry_id 1KQL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1KQL _struct.title 'Crystal structure of the C-terminal region of striated muscle alpha-tropomyosin at 2.7 angstrom resolution' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KQL _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'thin filament, tropomyosin, muscle regulation, coiled coil, contractile protein, four-helix bundle' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP GCN4_YEAST 1 DKVEELLSKNYHLENEVARLKKLV 255 P03069 ? 2 GB AAA42293 1 DDLEDELYAQKLKYKAISEELDHALNDMTSI 174 207514 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1KQL A 2 ? 25 ? P03069 255 ? 278 ? 230 253 2 2 1KQL A 26 ? 56 ? 207514 174 ? 204 ? 254 284 3 1 1KQL B 2 ? 25 ? P03069 255 ? 278 ? 230 253 4 2 1KQL B 26 ? 56 ? 207514 174 ? 204 ? 254 284 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KQL MET A 1 ? UNP P03069 ? ? 'initiating methionine' 229 1 3 1KQL MET B 1 ? UNP P03069 ? ? 'initiating methionine' 229 2 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 software_defined_assembly PISA tetrameric 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2350 ? 1 MORE -21 ? 1 'SSA (A^2)' 8630 ? 2 'ABSA (A^2)' 7310 ? 2 MORE -71 ? 2 'SSA (A^2)' 14630 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D 2 1,2 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+2/3 0.5000000000 0.8660254038 0.0000000000 -68.6010000000 0.8660254038 -0.5000000000 0.0000000000 118.8204174500 0.0000000000 0.0000000000 -1.0000000000 26.7140000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? SER A 55 ? MET A 229 SER A 283 1 ? 55 HELX_P HELX_P2 2 ASP B 2 ? THR B 54 ? ASP B 230 THR B 282 1 ? 53 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 277 ? ? -74.83 -81.63 2 1 ASP B 230 ? ? -174.97 -68.16 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 4 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 284 ? A ILE 56 2 1 Y 1 B SER 283 ? B SER 55 3 1 Y 1 B ILE 284 ? B ILE 56 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 HOH O O N N 134 HOH H1 H N N 135 HOH H2 H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 SER N N N N 226 SER CA C N S 227 SER C C N N 228 SER O O N N 229 SER CB C N N 230 SER OG O N N 231 SER OXT O N N 232 SER H H N N 233 SER H2 H N N 234 SER HA H N N 235 SER HB2 H N N 236 SER HB3 H N N 237 SER HG H N N 238 SER HXT H N N 239 THR N N N N 240 THR CA C N S 241 THR C C N N 242 THR O O N N 243 THR CB C N R 244 THR OG1 O N N 245 THR CG2 C N N 246 THR OXT O N N 247 THR H H N N 248 THR H2 H N N 249 THR HA H N N 250 THR HB H N N 251 THR HG1 H N N 252 THR HG21 H N N 253 THR HG22 H N N 254 THR HG23 H N N 255 THR HXT H N N 256 TYR N N N N 257 TYR CA C N S 258 TYR C C N N 259 TYR O O N N 260 TYR CB C N N 261 TYR CG C Y N 262 TYR CD1 C Y N 263 TYR CD2 C Y N 264 TYR CE1 C Y N 265 TYR CE2 C Y N 266 TYR CZ C Y N 267 TYR OH O N N 268 TYR OXT O N N 269 TYR H H N N 270 TYR H2 H N N 271 TYR HA H N N 272 TYR HB2 H N N 273 TYR HB3 H N N 274 TYR HD1 H N N 275 TYR HD2 H N N 276 TYR HE1 H N N 277 TYR HE2 H N N 278 TYR HH H N N 279 TYR HXT H N N 280 VAL N N N N 281 VAL CA C N S 282 VAL C C N N 283 VAL O O N N 284 VAL CB C N N 285 VAL CG1 C N N 286 VAL CG2 C N N 287 VAL OXT O N N 288 VAL H H N N 289 VAL H2 H N N 290 VAL HA H N N 291 VAL HB H N N 292 VAL HG11 H N N 293 VAL HG12 H N N 294 VAL HG13 H N N 295 VAL HG21 H N N 296 VAL HG22 H N N 297 VAL HG23 H N N 298 VAL HXT H N N 299 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 HOH O H1 sing N N 128 HOH O H2 sing N N 129 ILE N CA sing N N 130 ILE N H sing N N 131 ILE N H2 sing N N 132 ILE CA C sing N N 133 ILE CA CB sing N N 134 ILE CA HA sing N N 135 ILE C O doub N N 136 ILE C OXT sing N N 137 ILE CB CG1 sing N N 138 ILE CB CG2 sing N N 139 ILE CB HB sing N N 140 ILE CG1 CD1 sing N N 141 ILE CG1 HG12 sing N N 142 ILE CG1 HG13 sing N N 143 ILE CG2 HG21 sing N N 144 ILE CG2 HG22 sing N N 145 ILE CG2 HG23 sing N N 146 ILE CD1 HD11 sing N N 147 ILE CD1 HD12 sing N N 148 ILE CD1 HD13 sing N N 149 ILE OXT HXT sing N N 150 LEU N CA sing N N 151 LEU N H sing N N 152 LEU N H2 sing N N 153 LEU CA C sing N N 154 LEU CA CB sing N N 155 LEU CA HA sing N N 156 LEU C O doub N N 157 LEU C OXT sing N N 158 LEU CB CG sing N N 159 LEU CB HB2 sing N N 160 LEU CB HB3 sing N N 161 LEU CG CD1 sing N N 162 LEU CG CD2 sing N N 163 LEU CG HG sing N N 164 LEU CD1 HD11 sing N N 165 LEU CD1 HD12 sing N N 166 LEU CD1 HD13 sing N N 167 LEU CD2 HD21 sing N N 168 LEU CD2 HD22 sing N N 169 LEU CD2 HD23 sing N N 170 LEU OXT HXT sing N N 171 LYS N CA sing N N 172 LYS N H sing N N 173 LYS N H2 sing N N 174 LYS CA C sing N N 175 LYS CA CB sing N N 176 LYS CA HA sing N N 177 LYS C O doub N N 178 LYS C OXT sing N N 179 LYS CB CG sing N N 180 LYS CB HB2 sing N N 181 LYS CB HB3 sing N N 182 LYS CG CD sing N N 183 LYS CG HG2 sing N N 184 LYS CG HG3 sing N N 185 LYS CD CE sing N N 186 LYS CD HD2 sing N N 187 LYS CD HD3 sing N N 188 LYS CE NZ sing N N 189 LYS CE HE2 sing N N 190 LYS CE HE3 sing N N 191 LYS NZ HZ1 sing N N 192 LYS NZ HZ2 sing N N 193 LYS NZ HZ3 sing N N 194 LYS OXT HXT sing N N 195 MET N CA sing N N 196 MET N H sing N N 197 MET N H2 sing N N 198 MET CA C sing N N 199 MET CA CB sing N N 200 MET CA HA sing N N 201 MET C O doub N N 202 MET C OXT sing N N 203 MET CB CG sing N N 204 MET CB HB2 sing N N 205 MET CB HB3 sing N N 206 MET CG SD sing N N 207 MET CG HG2 sing N N 208 MET CG HG3 sing N N 209 MET SD CE sing N N 210 MET CE HE1 sing N N 211 MET CE HE2 sing N N 212 MET CE HE3 sing N N 213 MET OXT HXT sing N N 214 SER N CA sing N N 215 SER N H sing N N 216 SER N H2 sing N N 217 SER CA C sing N N 218 SER CA CB sing N N 219 SER CA HA sing N N 220 SER C O doub N N 221 SER C OXT sing N N 222 SER CB OG sing N N 223 SER CB HB2 sing N N 224 SER CB HB3 sing N N 225 SER OG HG sing N N 226 SER OXT HXT sing N N 227 THR N CA sing N N 228 THR N H sing N N 229 THR N H2 sing N N 230 THR CA C sing N N 231 THR CA CB sing N N 232 THR CA HA sing N N 233 THR C O doub N N 234 THR C OXT sing N N 235 THR CB OG1 sing N N 236 THR CB CG2 sing N N 237 THR CB HB sing N N 238 THR OG1 HG1 sing N N 239 THR CG2 HG21 sing N N 240 THR CG2 HG22 sing N N 241 THR CG2 HG23 sing N N 242 THR OXT HXT sing N N 243 TYR N CA sing N N 244 TYR N H sing N N 245 TYR N H2 sing N N 246 TYR CA C sing N N 247 TYR CA CB sing N N 248 TYR CA HA sing N N 249 TYR C O doub N N 250 TYR C OXT sing N N 251 TYR CB CG sing N N 252 TYR CB HB2 sing N N 253 TYR CB HB3 sing N N 254 TYR CG CD1 doub Y N 255 TYR CG CD2 sing Y N 256 TYR CD1 CE1 sing Y N 257 TYR CD1 HD1 sing N N 258 TYR CD2 CE2 doub Y N 259 TYR CD2 HD2 sing N N 260 TYR CE1 CZ doub Y N 261 TYR CE1 HE1 sing N N 262 TYR CE2 CZ sing Y N 263 TYR CE2 HE2 sing N N 264 TYR CZ OH sing N N 265 TYR OH HH sing N N 266 TYR OXT HXT sing N N 267 VAL N CA sing N N 268 VAL N H sing N N 269 VAL N H2 sing N N 270 VAL CA C sing N N 271 VAL CA CB sing N N 272 VAL CA HA sing N N 273 VAL C O doub N N 274 VAL C OXT sing N N 275 VAL CB CG1 sing N N 276 VAL CB CG2 sing N N 277 VAL CB HB sing N N 278 VAL CG1 HG11 sing N N 279 VAL CG1 HG12 sing N N 280 VAL CG1 HG13 sing N N 281 VAL CG2 HG21 sing N N 282 VAL CG2 HG22 sing N N 283 VAL CG2 HG23 sing N N 284 VAL OXT HXT sing N N 285 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details ;a specially built 56-residue two-stranded coiled-coil that contains a 24 residue fragment from the high resolution structure of the GCN4 leucine zipper ; # _atom_sites.entry_id 1KQL _atom_sites.fract_transf_matrix[1][1] 0.007289 _atom_sites.fract_transf_matrix[1][2] 0.004208 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008416 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024956 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_