data_1KUM # _entry.id 1KUM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KUM pdb_00001kum 10.2210/pdb1kum/pdb WWPDB D_1000174497 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1KUL _pdbx_database_related.details . _pdbx_database_related.content_type ensemble # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KUM _pdbx_database_status.recvd_initial_deposition_date 1996-01-12 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sorimachi, K.' 1 'Jacks, A.J.' 2 'Le Gal-Coeffet, M.-F.' 3 'Williamson, G.' 4 'Archer, D.B.' 5 'Williamson, M.P.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Solution structure of the granular starch binding domain of glucoamylase from Aspergillus niger by nuclear magnetic resonance spectroscopy. ; J.Mol.Biol. 259 970 987 1996 JMOBAK UK 0022-2836 0070 ? 8683599 10.1006/jmbi.1996.0374 1 '1H and 15N Assignments and Secondary Structure of the Starch-Binding Domain of Glucoamylase from Aspergillus Niger' Eur.J.Biochem. 233 568 ? 1995 EJBCAI IX 0014-2956 0262 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sorimachi, K.' 1 ? primary 'Jacks, A.J.' 2 ? primary 'Le Gal-Coeffet, M.F.' 3 ? primary 'Williamson, G.' 4 ? primary 'Archer, D.B.' 5 ? primary 'Williamson, M.P.' 6 ? 1 'Jacks, A.J.' 7 ? 1 'Sorimachi, K.' 8 ? 1 'Le Gal-Coeffet, M.F.' 9 ? 1 'Williamson, G.' 10 ? 1 'Archer, D.B.' 11 ? 1 'Williamson, M.P.' 12 ? # _cell.entry_id 1KUM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KUM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description GLUCOAMYLASE _entity.formula_weight 11884.820 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.2.1.3 _entity.pdbx_mutation ? _entity.pdbx_fragment 'BINDING DOMAIN, RESIDUES 509 - 616' _entity.details 'PH 5.2, 313 K' # _entity_name_com.entity_id 1 _entity_name_com.name '1,4-ALPHA-D-GLUCAN GLUCOHYDROLASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSV EWESDPNREYTVPQACGTSTATVTDTWR ; _entity_poly.pdbx_seq_one_letter_code_can ;CTTPTAVAVTFDLTATTTYGENIYLVGSISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSV EWESDPNREYTVPQACGTSTATVTDTWR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 THR n 1 3 THR n 1 4 PRO n 1 5 THR n 1 6 ALA n 1 7 VAL n 1 8 ALA n 1 9 VAL n 1 10 THR n 1 11 PHE n 1 12 ASP n 1 13 LEU n 1 14 THR n 1 15 ALA n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 TYR n 1 20 GLY n 1 21 GLU n 1 22 ASN n 1 23 ILE n 1 24 TYR n 1 25 LEU n 1 26 VAL n 1 27 GLY n 1 28 SER n 1 29 ILE n 1 30 SER n 1 31 GLN n 1 32 LEU n 1 33 GLY n 1 34 ASP n 1 35 TRP n 1 36 GLU n 1 37 THR n 1 38 SER n 1 39 ASP n 1 40 GLY n 1 41 ILE n 1 42 ALA n 1 43 LEU n 1 44 SER n 1 45 ALA n 1 46 ASP n 1 47 LYS n 1 48 TYR n 1 49 THR n 1 50 SER n 1 51 SER n 1 52 ASP n 1 53 PRO n 1 54 LEU n 1 55 TRP n 1 56 TYR n 1 57 VAL n 1 58 THR n 1 59 VAL n 1 60 THR n 1 61 LEU n 1 62 PRO n 1 63 ALA n 1 64 GLY n 1 65 GLU n 1 66 SER n 1 67 PHE n 1 68 GLU n 1 69 TYR n 1 70 LYS n 1 71 PHE n 1 72 ILE n 1 73 ARG n 1 74 ILE n 1 75 GLU n 1 76 SER n 1 77 ASP n 1 78 ASP n 1 79 SER n 1 80 VAL n 1 81 GLU n 1 82 TRP n 1 83 GLU n 1 84 SER n 1 85 ASP n 1 86 PRO n 1 87 ASN n 1 88 ARG n 1 89 GLU n 1 90 TYR n 1 91 THR n 1 92 VAL n 1 93 PRO n 1 94 GLN n 1 95 ALA n 1 96 CYS n 1 97 GLY n 1 98 THR n 1 99 SER n 1 100 THR n 1 101 ALA n 1 102 THR n 1 103 VAL n 1 104 THR n 1 105 ASP n 1 106 THR n 1 107 TRP n 1 108 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Aspergillus _entity_src_gen.pdbx_gene_src_gene 'A. NIGER GLAA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain AB4.1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aspergillus niger' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5061 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Aspergillus niger' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 5061 _entity_src_gen.host_org_genus Aspergillus _entity_src_gen.pdbx_host_org_gene 'A. NIGER GLAA' _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PIGF _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMYG_ASPNG _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P69328 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MSFRSLLALSGLVCTGLANVISKRATLDSWLSNEATVARTAILNNIGADGAWVSGADSGIVVASPSTDNPDYFYTWTRDS GLVLKTLVDLFRNGDTSLLSTIENYISAQAIVQGISNPSGDLSSGAGLGEPKFNVDETAYTGSWGRPQRDGPALRATAMI GFGQWLLDNGYTSTATDIVWPLVRNDLSYVAQYWNQTGYDLWEEVNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQ APEILCYLQSFWTGSFILANFDSSRSGKDANTLLGSIHTFDPEAACDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLS DSEAVAVGRYPEDTYYNGNPWFLCTLAAAEQLYDALYQWDKQGSLEVTDVSLDFFKALYSDAATGTYSSSSSTYSSIVDA VKTFADGFVSIVETHAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANNRRNSVVPASWGETSASSVPGTCAATSAIG TYSSVTVTSWPSIVATGGTTTTATPTGSGSVTSTSKTTATASKTSTSTSSTSCTTPTAVAVTFDLTATTTYGENIYLVGS ISQLGDWETSDGIALSADKYTSSDPLWYVTVTLPAGESFEYKFIRIESDDSVEWESDPNREYTVPQACGTSTATVTDTWR ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KUM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69328 _struct_ref_seq.db_align_beg 533 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 640 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 509 _struct_ref_seq.pdbx_auth_seq_align_end 616 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_ensemble.entry_id 1KUM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name X-PLOR _pdbx_nmr_software.version 3.1 _pdbx_nmr_software.authors BRUNGER _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1KUM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1KUM _struct.title 'GLUCOAMYLASE, GRANULAR STARCH-BINDING DOMAIN, NMR, MINIMIZED AVERAGE STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KUM _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'HYDROLASE, STARCH BINDING DOMAIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 30 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 32 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 538 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 540 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 96 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 509 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 604 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.021 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 7 ? B ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel B 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 99 ? TRP A 107 ? SER A 607 TRP A 615 A 2 THR A 5 ? ALA A 15 ? THR A 513 ALA A 523 A 3 PRO A 53 ? ALA A 63 ? PRO A 561 ALA A 571 A 4 ILE A 41 ? SER A 44 ? ILE A 549 SER A 552 A 5 ASN A 22 ? SER A 28 ? ASN A 530 SER A 536 A 6 GLU A 65 ? ILE A 74 ? GLU A 573 ILE A 582 A 7 GLU A 81 ? GLU A 83 ? GLU A 589 GLU A 591 B 1 SER A 99 ? TRP A 107 ? SER A 607 TRP A 615 B 2 THR A 5 ? ALA A 15 ? THR A 513 ALA A 523 B 3 PRO A 53 ? ALA A 63 ? PRO A 561 ALA A 571 B 4 ILE A 41 ? SER A 44 ? ILE A 549 SER A 552 B 5 ASN A 22 ? SER A 28 ? ASN A 530 SER A 536 B 6 GLU A 65 ? ILE A 74 ? GLU A 573 ILE A 582 B 7 ARG A 88 ? VAL A 92 ? ARG A 596 VAL A 600 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 101 ? O ALA A 609 N THR A 10 ? N THR A 518 A 2 3 O VAL A 9 ? O VAL A 517 N VAL A 59 ? N VAL A 567 A 3 4 O TYR A 56 ? O TYR A 564 N SER A 44 ? N SER A 552 A 4 5 O ILE A 41 ? O ILE A 549 N LEU A 25 ? N LEU A 533 A 5 6 O VAL A 26 ? O VAL A 534 N LYS A 70 ? N LYS A 578 A 6 7 O ARG A 73 ? O ARG A 581 N GLU A 81 ? N GLU A 589 B 1 2 O ALA A 101 ? O ALA A 609 N THR A 10 ? N THR A 518 B 2 3 O VAL A 9 ? O VAL A 517 N VAL A 59 ? N VAL A 567 B 3 4 O TYR A 56 ? O TYR A 564 N SER A 44 ? N SER A 552 B 4 5 O ILE A 41 ? O ILE A 549 N LEU A 25 ? N LEU A 533 B 5 6 O VAL A 26 ? O VAL A 534 N LYS A 70 ? N LYS A 578 B 6 7 O PHE A 67 ? O PHE A 575 N TYR A 90 ? N TYR A 598 # _database_PDB_matrix.entry_id 1KUM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KUM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 509 509 CYS CYS A . n A 1 2 THR 2 510 510 THR THR A . n A 1 3 THR 3 511 511 THR THR A . n A 1 4 PRO 4 512 512 PRO PRO A . n A 1 5 THR 5 513 513 THR THR A . n A 1 6 ALA 6 514 514 ALA ALA A . n A 1 7 VAL 7 515 515 VAL VAL A . n A 1 8 ALA 8 516 516 ALA ALA A . n A 1 9 VAL 9 517 517 VAL VAL A . n A 1 10 THR 10 518 518 THR THR A . n A 1 11 PHE 11 519 519 PHE PHE A . n A 1 12 ASP 12 520 520 ASP ASP A . n A 1 13 LEU 13 521 521 LEU LEU A . n A 1 14 THR 14 522 522 THR THR A . n A 1 15 ALA 15 523 523 ALA ALA A . n A 1 16 THR 16 524 524 THR THR A . n A 1 17 THR 17 525 525 THR THR A . n A 1 18 THR 18 526 526 THR THR A . n A 1 19 TYR 19 527 527 TYR TYR A . n A 1 20 GLY 20 528 528 GLY GLY A . n A 1 21 GLU 21 529 529 GLU GLU A . n A 1 22 ASN 22 530 530 ASN ASN A . n A 1 23 ILE 23 531 531 ILE ILE A . n A 1 24 TYR 24 532 532 TYR TYR A . n A 1 25 LEU 25 533 533 LEU LEU A . n A 1 26 VAL 26 534 534 VAL VAL A . n A 1 27 GLY 27 535 535 GLY GLY A . n A 1 28 SER 28 536 536 SER SER A . n A 1 29 ILE 29 537 537 ILE ILE A . n A 1 30 SER 30 538 538 SER SER A . n A 1 31 GLN 31 539 539 GLN GLN A . n A 1 32 LEU 32 540 540 LEU LEU A . n A 1 33 GLY 33 541 541 GLY GLY A . n A 1 34 ASP 34 542 542 ASP ASP A . n A 1 35 TRP 35 543 543 TRP TRP A . n A 1 36 GLU 36 544 544 GLU GLU A . n A 1 37 THR 37 545 545 THR THR A . n A 1 38 SER 38 546 546 SER SER A . n A 1 39 ASP 39 547 547 ASP ASP A . n A 1 40 GLY 40 548 548 GLY GLY A . n A 1 41 ILE 41 549 549 ILE ILE A . n A 1 42 ALA 42 550 550 ALA ALA A . n A 1 43 LEU 43 551 551 LEU LEU A . n A 1 44 SER 44 552 552 SER SER A . n A 1 45 ALA 45 553 553 ALA ALA A . n A 1 46 ASP 46 554 554 ASP ASP A . n A 1 47 LYS 47 555 555 LYS LYS A . n A 1 48 TYR 48 556 556 TYR TYR A . n A 1 49 THR 49 557 557 THR THR A . n A 1 50 SER 50 558 558 SER SER A . n A 1 51 SER 51 559 559 SER SER A . n A 1 52 ASP 52 560 560 ASP ASP A . n A 1 53 PRO 53 561 561 PRO PRO A . n A 1 54 LEU 54 562 562 LEU LEU A . n A 1 55 TRP 55 563 563 TRP TRP A . n A 1 56 TYR 56 564 564 TYR TYR A . n A 1 57 VAL 57 565 565 VAL VAL A . n A 1 58 THR 58 566 566 THR THR A . n A 1 59 VAL 59 567 567 VAL VAL A . n A 1 60 THR 60 568 568 THR THR A . n A 1 61 LEU 61 569 569 LEU LEU A . n A 1 62 PRO 62 570 570 PRO PRO A . n A 1 63 ALA 63 571 571 ALA ALA A . n A 1 64 GLY 64 572 572 GLY GLY A . n A 1 65 GLU 65 573 573 GLU GLU A . n A 1 66 SER 66 574 574 SER SER A . n A 1 67 PHE 67 575 575 PHE PHE A . n A 1 68 GLU 68 576 576 GLU GLU A . n A 1 69 TYR 69 577 577 TYR TYR A . n A 1 70 LYS 70 578 578 LYS LYS A . n A 1 71 PHE 71 579 579 PHE PHE A . n A 1 72 ILE 72 580 580 ILE ILE A . n A 1 73 ARG 73 581 581 ARG ARG A . n A 1 74 ILE 74 582 582 ILE ILE A . n A 1 75 GLU 75 583 583 GLU GLU A . n A 1 76 SER 76 584 584 SER SER A . n A 1 77 ASP 77 585 585 ASP ASP A . n A 1 78 ASP 78 586 586 ASP ASP A . n A 1 79 SER 79 587 587 SER SER A . n A 1 80 VAL 80 588 588 VAL VAL A . n A 1 81 GLU 81 589 589 GLU GLU A . n A 1 82 TRP 82 590 590 TRP TRP A . n A 1 83 GLU 83 591 591 GLU GLU A . n A 1 84 SER 84 592 592 SER SER A . n A 1 85 ASP 85 593 593 ASP ASP A . n A 1 86 PRO 86 594 594 PRO PRO A . n A 1 87 ASN 87 595 595 ASN ASN A . n A 1 88 ARG 88 596 596 ARG ARG A . n A 1 89 GLU 89 597 597 GLU GLU A . n A 1 90 TYR 90 598 598 TYR TYR A . n A 1 91 THR 91 599 599 THR THR A . n A 1 92 VAL 92 600 600 VAL VAL A . n A 1 93 PRO 93 601 601 PRO PRO A . n A 1 94 GLN 94 602 602 GLN GLN A . n A 1 95 ALA 95 603 603 ALA ALA A . n A 1 96 CYS 96 604 604 CYS CYS A . n A 1 97 GLY 97 605 605 GLY GLY A . n A 1 98 THR 98 606 606 THR THR A . n A 1 99 SER 99 607 607 SER SER A . n A 1 100 THR 100 608 608 THR THR A . n A 1 101 ALA 101 609 609 ALA ALA A . n A 1 102 THR 102 610 610 THR THR A . n A 1 103 VAL 103 611 611 VAL VAL A . n A 1 104 THR 104 612 612 THR THR A . n A 1 105 ASP 105 613 613 ASP ASP A . n A 1 106 THR 106 614 614 THR THR A . n A 1 107 TRP 107 615 615 TRP TRP A . n A 1 108 ARG 108 616 616 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-07-11 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal X-PLOR 'model building' 3.1 ? 1 X-PLOR refinement 3.1 ? 2 X-PLOR phasing 3.1 ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 519 ? ? HA A TYR 564 ? ? 1.29 2 1 O A LEU 551 ? ? HZ3 A TRP 563 ? ? 1.49 3 1 HA A LEU 521 ? ? O A ASP 613 ? ? 1.54 4 1 N A THR 525 ? ? OH A TYR 556 ? ? 2.08 5 1 O A GLY 535 ? ? O A ASP 542 ? ? 2.09 6 1 O A ASP 520 ? ? O A ASP 613 ? ? 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 510 ? ? -79.96 -151.86 2 1 THR A 524 ? ? -90.27 38.59 3 1 THR A 525 ? ? -46.35 162.44 4 1 GLN A 539 ? ? -39.11 -39.74 5 1 LEU A 540 ? ? -105.26 40.52 6 1 ASP A 542 ? ? 81.95 -64.49 7 1 TRP A 543 ? ? -173.91 39.89 8 1 THR A 557 ? ? -151.89 -67.17 9 1 SER A 558 ? ? -148.19 -43.72 10 1 TYR A 564 ? ? 151.89 148.65 11 1 ALA A 571 ? ? 76.90 97.68 12 1 GLU A 573 ? ? 174.78 147.11 13 1 SER A 574 ? ? -84.16 47.30 14 1 PHE A 575 ? ? -35.18 160.09 15 1 GLU A 583 ? ? -72.47 -169.49 16 1 GLU A 591 ? ? -37.29 136.83 17 1 SER A 592 ? ? -66.59 -135.45 18 1 ASN A 595 ? ? -66.32 -165.40 19 1 GLN A 602 ? ? -112.03 60.79 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 581 ? ? 0.215 'SIDE CHAIN' 2 1 ARG A 596 ? ? 0.276 'SIDE CHAIN' 3 1 ARG A 616 ? ? 0.296 'SIDE CHAIN' #