data_1KW4 # _entry.id 1KW4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1KW4 pdb_00001kw4 10.2210/pdb1kw4/pdb RCSB RCSB015395 ? ? WWPDB D_1000015395 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1JI7 _pdbx_database_related.details 'ETS-RELATED PROTEIN TEL1' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1KW4 _pdbx_database_status.recvd_initial_deposition_date 2002-01-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, C.A.' 1 'Gingery, M.' 2 'M Pilpa, R.' 3 'Bowie, J.U.' 4 # _citation.id primary _citation.title 'The SAM domain of polyhomeotic forms a helical polymer.' _citation.journal_abbrev Nat.Struct.Biol. _citation.journal_volume 9 _citation.page_first 453 _citation.page_last 457 _citation.year 2002 _citation.journal_id_ASTM NSBIEW _citation.country US _citation.journal_id_ISSN 1072-8368 _citation.journal_id_CSD 2024 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 11992127 _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, C.A.' 1 ? primary 'Gingery, M.' 2 ? primary 'Pilpa, R.M.' 3 ? primary 'Bowie, J.U.' 4 ? # _cell.entry_id 1KW4 _cell.length_a 59.836 _cell.length_b 59.836 _cell.length_c 44.896 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1KW4 _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Polyhomeotic 10319.455 1 ? L51R 'SAM domain' ? 2 water nat water 18.015 56 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;METKRVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLRLKEKHLVNA(MSE)G(MSE)KLGPALKIV AKVESIKEVRDHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;METKRVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLRLKEKHLVNAMGMKLGPALKIVAKVESIKE VRDHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 THR n 1 4 LYS n 1 5 ARG n 1 6 VAL n 1 7 ASN n 1 8 GLY n 1 9 THR n 1 10 ASP n 1 11 ARG n 1 12 PRO n 1 13 PRO n 1 14 ILE n 1 15 SER n 1 16 SER n 1 17 TRP n 1 18 SER n 1 19 VAL n 1 20 ASP n 1 21 ASP n 1 22 VAL n 1 23 SER n 1 24 ASN n 1 25 PHE n 1 26 ILE n 1 27 ARG n 1 28 GLU n 1 29 LEU n 1 30 PRO n 1 31 GLY n 1 32 CYS n 1 33 GLN n 1 34 ASP n 1 35 TYR n 1 36 VAL n 1 37 ASP n 1 38 ASP n 1 39 PHE n 1 40 ILE n 1 41 GLN n 1 42 GLN n 1 43 GLU n 1 44 ILE n 1 45 ASP n 1 46 GLY n 1 47 GLN n 1 48 ALA n 1 49 LEU n 1 50 LEU n 1 51 ARG n 1 52 LEU n 1 53 LYS n 1 54 GLU n 1 55 LYS n 1 56 HIS n 1 57 LEU n 1 58 VAL n 1 59 ASN n 1 60 ALA n 1 61 MSE n 1 62 GLY n 1 63 MSE n 1 64 LYS n 1 65 LEU n 1 66 GLY n 1 67 PRO n 1 68 ALA n 1 69 LEU n 1 70 LYS n 1 71 ILE n 1 72 VAL n 1 73 ALA n 1 74 LYS n 1 75 VAL n 1 76 GLU n 1 77 SER n 1 78 ILE n 1 79 LYS n 1 80 GLU n 1 81 VAL n 1 82 ARG n 1 83 ASP n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'fruit fly' _entity_src_gen.gene_src_genus Drosophila _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHP_DROME _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PKSSEVNGTDRPPISSWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHLVNAMGMKLGPALKIVAKVESIKE V ; _struct_ref.pdbx_align_begin 1497 _struct_ref.pdbx_db_accession P39769 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1KW4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P39769 _struct_ref_seq.db_align_beg 1497 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1577 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1KW4 MET A 1 ? UNP P39769 PRO 1497 'cloning artifact' 1 1 1 1KW4 GLU A 2 ? UNP P39769 LYS 1498 'cloning artifact' 2 2 1 1KW4 THR A 3 ? UNP P39769 SER 1499 'cloning artifact' 3 3 1 1KW4 LYS A 4 ? UNP P39769 SER 1500 'cloning artifact' 4 4 1 1KW4 ARG A 5 ? UNP P39769 GLU 1501 'cloning artifact' 5 5 1 1KW4 ARG A 51 ? UNP P39769 LEU 1547 'engineered mutation' 51 6 1 1KW4 MSE A 61 ? UNP P39769 MET 1557 'modified residue' 61 7 1 1KW4 MSE A 63 ? UNP P39769 MET 1559 'modified residue' 63 8 1 1KW4 ARG A 82 ? UNP P39769 ? ? 'cloning artifact' 82 9 1 1KW4 ASP A 83 ? UNP P39769 ? ? 'cloning artifact' 83 10 1 1KW4 HIS A 84 ? UNP P39769 ? ? 'expression tag' 84 11 1 1KW4 HIS A 85 ? UNP P39769 ? ? 'expression tag' 85 12 1 1KW4 HIS A 86 ? UNP P39769 ? ? 'expression tag' 86 13 1 1KW4 HIS A 87 ? UNP P39769 ? ? 'expression tag' 87 14 1 1KW4 HIS A 88 ? UNP P39769 ? ? 'expression tag' 88 15 1 1KW4 HIS A 89 ? UNP P39769 ? ? 'expression tag' 89 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1KW4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 45.27 _exptl_crystal.density_Matthews 2.25 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pdbx_details 'Li2SO4, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-04-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.969575 1.0 2 0.97855 1.0 3 0.979224 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X8C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X8C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.969575, 0.97855, 0.979224' # _reflns.entry_id 1KW4 _reflns.observed_criterion_sigma_I -3 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 20 _reflns.d_resolution_high 1.75 _reflns.number_obs 17395 _reflns.number_all ? _reflns.percent_possible_obs 98 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 27.5 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all 97 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 1KW4 _refine.ls_number_reflns_obs 9145 _refine.ls_number_reflns_all 9335 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1256045.07 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.ls_d_res_low 1.81 _refine.ls_d_res_high 1.75 _refine.ls_percent_reflns_obs 98.0 _refine.ls_R_factor_obs 0.2200000 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2200000 _refine.ls_R_factor_R_free 0.2340000 _refine.ls_R_factor_R_free_error 0.011 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.3 _refine.ls_number_reflns_R_free 488 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 31.2 _refine.aniso_B[1][1] -2.82 _refine.aniso_B[2][2] -2.82 _refine.aniso_B[3][3] 5.64 _refine.aniso_B[1][2] 0.20 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.407488 _refine.solvent_model_param_bsol 68.2429 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF 1256045.07 _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1KW4 _refine_analyze.Luzzati_coordinate_error_obs 0.21 _refine_analyze.Luzzati_sigma_a_obs 0.12 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.25 _refine_analyze.Luzzati_sigma_a_free 0.12 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 551 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 56 _refine_hist.number_atoms_total 607 _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 1.81 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.2 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 18.5 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.94 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.54 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.43 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.67 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.20 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.75 _refine_ls_shell.d_res_low 1.81 _refine_ls_shell.number_reflns_R_work 1357 _refine_ls_shell.R_factor_R_work 0.2440000 _refine_ls_shell.percent_reflns_obs 91.8 _refine_ls_shell.R_factor_R_free 0.2610000 _refine_ls_shell.R_factor_R_free_error 0.033 _refine_ls_shell.percent_reflns_R_free 4.4 _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM ? 'X-RAY DIFFRACTION' # _struct.entry_id 1KW4 _struct.title 'Polyhomeotic SAM domain structure' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1KW4 _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'SAM domain, Polycomb Group, polymer, DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 13 ? TRP A 17 ? PRO A 13 TRP A 17 5 ? 5 HELX_P HELX_P2 2 SER A 18 ? GLU A 28 ? SER A 18 GLU A 28 1 ? 11 HELX_P HELX_P3 3 CYS A 32 ? ASP A 34 ? CYS A 32 ASP A 34 5 ? 3 HELX_P HELX_P4 4 TYR A 35 ? GLN A 42 ? TYR A 35 GLN A 42 1 ? 8 HELX_P HELX_P5 5 ASP A 45 ? LEU A 52 ? ASP A 45 LEU A 52 1 ? 8 HELX_P HELX_P6 6 LYS A 53 ? ASN A 59 ? LYS A 53 ASN A 59 1 ? 7 HELX_P HELX_P7 7 LYS A 64 ? LYS A 79 ? LYS A 64 LYS A 79 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 60 C ? ? ? 1_555 A MSE 61 N ? ? A ALA 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 61 C ? ? ? 1_555 A GLY 62 N ? ? A MSE 61 A GLY 62 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A GLY 62 C ? ? ? 1_555 A MSE 63 N ? ? A GLY 62 A MSE 63 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale4 covale both ? A MSE 63 C ? ? ? 1_555 A LYS 64 N ? ? A MSE 63 A LYS 64 1_555 ? ? ? ? ? ? ? 1.332 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1KW4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1KW4 _atom_sites.fract_transf_matrix[1][1] 0.016712 _atom_sites.fract_transf_matrix[1][2] 0.009649 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019298 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022274 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 LYS 4 4 ? ? ? A . n A 1 5 ARG 5 5 ? ? ? A . n A 1 6 VAL 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 THR 9 9 ? ? ? A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 TRP 17 17 17 TRP TRP A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 MSE 61 61 61 MSE MSE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 MSE 63 63 63 MSE MSE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLU 80 80 ? ? ? A . n A 1 81 VAL 81 81 ? ? ? A . n A 1 82 ARG 82 82 ? ? ? A . n A 1 83 ASP 83 83 ? ? ? A . n A 1 84 HIS 84 84 ? ? ? A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 90 1 HOH TIP A . B 2 HOH 2 91 2 HOH TIP A . B 2 HOH 3 92 3 HOH TIP A . B 2 HOH 4 93 4 HOH TIP A . B 2 HOH 5 94 5 HOH TIP A . B 2 HOH 6 95 6 HOH TIP A . B 2 HOH 7 96 7 HOH TIP A . B 2 HOH 8 97 8 HOH TIP A . B 2 HOH 9 98 9 HOH TIP A . B 2 HOH 10 99 10 HOH TIP A . B 2 HOH 11 100 11 HOH TIP A . B 2 HOH 12 101 12 HOH TIP A . B 2 HOH 13 102 13 HOH TIP A . B 2 HOH 14 103 14 HOH TIP A . B 2 HOH 15 104 15 HOH TIP A . B 2 HOH 16 105 16 HOH TIP A . B 2 HOH 17 106 17 HOH TIP A . B 2 HOH 18 107 18 HOH TIP A . B 2 HOH 19 108 19 HOH TIP A . B 2 HOH 20 109 20 HOH TIP A . B 2 HOH 21 110 21 HOH TIP A . B 2 HOH 22 111 22 HOH TIP A . B 2 HOH 23 112 23 HOH TIP A . B 2 HOH 24 113 24 HOH TIP A . B 2 HOH 25 114 25 HOH TIP A . B 2 HOH 26 115 26 HOH TIP A . B 2 HOH 27 116 27 HOH TIP A . B 2 HOH 28 117 28 HOH TIP A . B 2 HOH 29 118 29 HOH TIP A . B 2 HOH 30 119 30 HOH TIP A . B 2 HOH 31 120 31 HOH TIP A . B 2 HOH 32 121 32 HOH TIP A . B 2 HOH 33 122 33 HOH TIP A . B 2 HOH 34 123 34 HOH TIP A . B 2 HOH 35 124 35 HOH TIP A . B 2 HOH 36 125 36 HOH TIP A . B 2 HOH 37 126 37 HOH TIP A . B 2 HOH 38 127 38 HOH TIP A . B 2 HOH 39 128 39 HOH TIP A . B 2 HOH 40 129 40 HOH TIP A . B 2 HOH 41 130 41 HOH TIP A . B 2 HOH 42 131 42 HOH TIP A . B 2 HOH 43 132 43 HOH TIP A . B 2 HOH 44 133 44 HOH TIP A . B 2 HOH 45 134 45 HOH TIP A . B 2 HOH 46 135 46 HOH TIP A . B 2 HOH 47 136 47 HOH TIP A . B 2 HOH 48 137 48 HOH TIP A . B 2 HOH 49 138 49 HOH TIP A . B 2 HOH 50 139 50 HOH TIP A . B 2 HOH 51 140 51 HOH TIP A . B 2 HOH 52 141 52 HOH TIP A . B 2 HOH 53 142 53 HOH TIP A . B 2 HOH 54 143 54 HOH TIP A . B 2 HOH 55 144 55 HOH TIP A . B 2 HOH 56 145 56 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 61 A MSE 61 ? MET SELENOMETHIONINE 2 A MSE 63 A MSE 63 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-05 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' struct_conn 3 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SOLVE phasing . ? 1 CNS refinement 1.1 ? 2 DENZO 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ; BIOMOLECULE: 1 THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S). THE RELEVANT BIOLOGICAL UNIT MAY BE THE 65 POLYMER. HOWEVER, THE EXACT STOICHIOMETRY OF THE POLYMER CANNOT BE STATED. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A LYS 4 ? A LYS 4 5 1 Y 1 A ARG 5 ? A ARG 5 6 1 Y 1 A VAL 6 ? A VAL 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A THR 9 ? A THR 9 10 1 Y 1 A GLU 80 ? A GLU 80 11 1 Y 1 A VAL 81 ? A VAL 81 12 1 Y 1 A ARG 82 ? A ARG 82 13 1 Y 1 A ASP 83 ? A ASP 83 14 1 Y 1 A HIS 84 ? A HIS 84 15 1 Y 1 A HIS 85 ? A HIS 85 16 1 Y 1 A HIS 86 ? A HIS 86 17 1 Y 1 A HIS 87 ? A HIS 87 18 1 Y 1 A HIS 88 ? A HIS 88 19 1 Y 1 A HIS 89 ? A HIS 89 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #