data_1L6U # _entry.id 1L6U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L6U pdb_00001l6u 10.2210/pdb1l6u/pdb RCSB RCSB015698 ? ? WWPDB D_1000015698 ? ? BMRB 4566 ? 10.13018/BMR4566 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-06-26 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-02-05 5 'Structure model' 2 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Derived calculations' 11 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_struct_assembly 6 4 'Structure model' pdbx_struct_assembly_prop 7 4 'Structure model' pdbx_struct_oper_list 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_entry_details 12 5 'Structure model' pdbx_modification_feature 13 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.auth_atom_id' 2 4 'Structure model' '_atom_site.label_atom_id' 3 4 'Structure model' '_pdbx_database_status.status_code_cs' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L6U _pdbx_database_status.recvd_initial_deposition_date 2002-03-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 4566 'Assignment of oxidized bovine Adrenodoxin' unspecified PDB 1L6V 'Structure of reduced bovine Adrenodoxin' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Beilke, D.' 1 'Weiss, R.' 2 'Lohr, F.' 3 'Pristovsek, P.' 4 'Hannemann, F.' 5 'Bernhardt, R.' 6 'Rueterjans, H.' 7 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;A new electron transport mechanism in mitochondrial steroid hydroxylase systems based on structural changes upon the reduction of adrenodoxin. ; Biochemistry 41 7969 7978 2002 BICHAW US 0006-2960 0033 ? 12069587 10.1021/bi0160361 1 'NEW ASPECTS OF ELECTRON TRANSFER REVEALED BY THE CRYSTAL STRUCTURE OF A TRUNCATED BOVINE ADRENODOXIN, ADX(4-108)' Structure 6 269 280 1998 STRUE6 UK 0969-2126 2005 ? ? '10.1016/S0969-2126(98)00031-8' # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Beilke, D.' 1 ? primary 'Weiss, R.' 2 ? primary 'Lohr, F.' 3 ? primary 'Pristovsek, P.' 4 ? primary 'Hannemann, F.' 5 ? primary 'Bernhardt, R.' 6 ? primary 'Ruterjans, H.' 7 ? 1 'Muller, A.' 8 ? 1 'Muller, J.J.' 9 ? 1 'Muller, Y.A.' 10 ? 1 'Uhlmann, H.' 11 ? 1 'Bernhardt, R.' 12 ? 1 'Heinemann, U.' 13 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Adrenodoxin 1' 14061.761 1 ? ? ? ? 2 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Adrenal ferredoxin, Hepato-ferredoxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDL AYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE ; _entity_poly.pdbx_seq_one_letter_code_can ;SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDL AYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'FE2/S2 (INORGANIC) CLUSTER' _pdbx_entity_nonpoly.comp_id FES # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 SER n 1 4 GLU n 1 5 ASP n 1 6 LYS n 1 7 ILE n 1 8 THR n 1 9 VAL n 1 10 HIS n 1 11 PHE n 1 12 ILE n 1 13 ASN n 1 14 ARG n 1 15 ASP n 1 16 GLY n 1 17 GLU n 1 18 THR n 1 19 LEU n 1 20 THR n 1 21 THR n 1 22 LYS n 1 23 GLY n 1 24 LYS n 1 25 ILE n 1 26 GLY n 1 27 ASP n 1 28 SER n 1 29 LEU n 1 30 LEU n 1 31 ASP n 1 32 VAL n 1 33 VAL n 1 34 VAL n 1 35 GLN n 1 36 ASN n 1 37 ASN n 1 38 LEU n 1 39 ASP n 1 40 ILE n 1 41 ASP n 1 42 GLY n 1 43 PHE n 1 44 GLY n 1 45 ALA n 1 46 CYS n 1 47 GLU n 1 48 GLY n 1 49 THR n 1 50 LEU n 1 51 ALA n 1 52 CYS n 1 53 SER n 1 54 THR n 1 55 CYS n 1 56 HIS n 1 57 LEU n 1 58 ILE n 1 59 PHE n 1 60 GLU n 1 61 GLN n 1 62 HIS n 1 63 ILE n 1 64 PHE n 1 65 GLU n 1 66 LYS n 1 67 LEU n 1 68 GLU n 1 69 ALA n 1 70 ILE n 1 71 THR n 1 72 ASP n 1 73 GLU n 1 74 GLU n 1 75 ASN n 1 76 ASP n 1 77 MET n 1 78 LEU n 1 79 ASP n 1 80 LEU n 1 81 ALA n 1 82 TYR n 1 83 GLY n 1 84 LEU n 1 85 THR n 1 86 ASP n 1 87 ARG n 1 88 SER n 1 89 ARG n 1 90 LEU n 1 91 GLY n 1 92 CYS n 1 93 GLN n 1 94 ILE n 1 95 CYS n 1 96 LEU n 1 97 THR n 1 98 LYS n 1 99 ALA n 1 100 MET n 1 101 ASP n 1 102 ASN n 1 103 MET n 1 104 THR n 1 105 VAL n 1 106 ARG n 1 107 VAL n 1 108 PRO n 1 109 ASP n 1 110 ALA n 1 111 VAL n 1 112 SER n 1 113 ASP n 1 114 ALA n 1 115 ARG n 1 116 GLU n 1 117 SER n 1 118 ILE n 1 119 ASP n 1 120 MET n 1 121 GLY n 1 122 MET n 1 123 ASN n 1 124 SER n 1 125 SER n 1 126 LYS n 1 127 ILE n 1 128 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name cattle _entity_src_gen.gene_src_genus Bos _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ 'adrenal gland' _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 CYS 92 92 92 CYS CYS A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 ASP 109 109 ? ? ? A . n A 1 110 ALA 110 110 ? ? ? A . n A 1 111 VAL 111 111 ? ? ? A . n A 1 112 SER 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 ALA 114 114 ? ? ? A . n A 1 115 ARG 115 115 ? ? ? A . n A 1 116 GLU 116 116 ? ? ? A . n A 1 117 SER 117 117 ? ? ? A . n A 1 118 ILE 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 MET 120 120 ? ? ? A . n A 1 121 GLY 121 121 ? ? ? A . n A 1 122 MET 122 122 ? ? ? A . n A 1 123 ASN 123 123 ? ? ? A . n A 1 124 SER 124 124 ? ? ? A . n A 1 125 SER 125 125 ? ? ? A . n A 1 126 LYS 126 126 ? ? ? A . n A 1 127 ILE 127 127 ? ? ? A . n A 1 128 GLU 128 128 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FES _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 146 _pdbx_nonpoly_scheme.auth_seq_num 146 _pdbx_nonpoly_scheme.pdb_mon_id FES _pdbx_nonpoly_scheme.auth_mon_id FES _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 2 1 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 3 1 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 4 1 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 5 1 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 6 1 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 7 1 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 8 1 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 9 2 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 10 2 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 11 2 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 12 2 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 13 2 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 14 2 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 15 2 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 16 2 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 17 3 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 18 3 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 19 3 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 20 3 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 21 3 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 22 3 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 23 3 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 24 3 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 25 4 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 26 4 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 27 4 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 28 4 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 29 4 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 30 4 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 31 4 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 32 4 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 33 5 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 34 5 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 35 5 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 36 5 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 37 5 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 38 5 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 39 5 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 40 5 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 41 6 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 42 6 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 43 6 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 44 6 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 45 6 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 46 6 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 47 6 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 48 6 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 49 7 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 50 7 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 51 7 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 52 7 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 53 7 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 54 7 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 55 7 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 56 7 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 57 8 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 58 8 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 59 8 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 60 8 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 61 8 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 62 8 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 63 8 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 64 8 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 65 9 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 66 9 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 67 9 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 68 9 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 69 9 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 70 9 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 71 9 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 72 9 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ 73 10 Y 1 A LYS 6 ? NZ ? A LYS 6 NZ 74 10 Y 1 A HIS 10 ? NE2 ? A HIS 10 NE2 75 10 Y 1 A LYS 22 ? NZ ? A LYS 22 NZ 76 10 Y 1 A LYS 24 ? NZ ? A LYS 24 NZ 77 10 Y 1 A HIS 56 ? NE2 ? A HIS 56 NE2 78 10 Y 1 A HIS 62 ? NE2 ? A HIS 62 NE2 79 10 Y 1 A LYS 66 ? NZ ? A LYS 66 NZ 80 10 Y 1 A LYS 98 ? NZ ? A LYS 98 NZ # _exptl.entry_id 1L6U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1L6U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1L6U _struct.title 'NMR STRUCTURE OF OXIDIZED ADRENODOXIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L6U _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text ;[2Fe-2S]-cluster, primary interaction domain (helix from Asp72-Asp79), (alpha-beta)-Protein, 5 Helices, 5 beta strands, ELECTRON TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ADX1_BOVIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAARLLRVASAALGDTAGRWRLLARPRAGAGGLRGSRGPGLGGGAVATRTLSVSGRAQSSSEDKITVHFINRDGETLTTK GKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDN MTVRVPDAVSDARESIDMGMNSSKIE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P00257 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L6U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00257 _struct_ref_seq.db_align_beg 59 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 186 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 250 ? 1 MORE -17 ? 1 'SSA (A^2)' 6510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 30 ? ASN A 36 ? LEU A 30 ASN A 36 1 ? 7 HELX_P HELX_P2 2 THR A 71 ? LEU A 78 ? THR A 71 LEU A 78 1 ? 8 HELX_P HELX_P3 3 THR A 97 ? ASP A 101 ? THR A 97 ASP A 101 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 55 SG ? ? ? 1_555 A CYS 92 SG ? ? A CYS 55 A CYS 92 1_555 ? ? ? ? ? ? ? 2.976 ? ? metalc1 metalc ? ? A CYS 46 SG ? ? ? 1_555 B FES . FE1 ? ? A CYS 46 A FES 146 1_555 ? ? ? ? ? ? ? 2.186 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 46 ? A CYS 46 ? 1_555 FE1 ? B FES . ? A FES 146 ? 1_555 S1 ? B FES . ? A FES 146 ? 1_555 97.3 ? 2 SG ? A CYS 46 ? A CYS 46 ? 1_555 FE1 ? B FES . ? A FES 146 ? 1_555 S2 ? B FES . ? A FES 146 ? 1_555 110.2 ? 3 S1 ? B FES . ? A FES 146 ? 1_555 FE1 ? B FES . ? A FES 146 ? 1_555 S2 ? B FES . ? A FES 146 ? 1_555 92.0 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 55 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 92 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 55 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 92 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 19 ? THR A 21 ? LEU A 19 THR A 21 A 2 VAL A 9 ? ILE A 12 ? VAL A 9 ILE A 12 A 3 MET A 103 ? ARG A 106 ? MET A 103 ARG A 106 A 4 LEU A 57 ? PHE A 59 ? LEU A 57 PHE A 59 A 5 SER A 88 ? ARG A 89 ? SER A 88 ARG A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 19 ? O LEU A 19 N PHE A 11 ? N PHE A 11 A 2 3 N ILE A 12 ? N ILE A 12 O VAL A 105 ? O VAL A 105 A 3 4 O ARG A 106 ? O ARG A 106 N ILE A 58 ? N ILE A 58 A 4 5 N LEU A 57 ? N LEU A 57 O ARG A 89 ? O ARG A 89 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id FES _struct_site.pdbx_auth_seq_id 146 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 7 _struct_site.details 'BINDING SITE FOR RESIDUE FES A 146' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 GLY A 44 ? GLY A 44 . ? 1_555 ? 2 AC1 7 CYS A 46 ? CYS A 46 . ? 1_555 ? 3 AC1 7 GLY A 48 ? GLY A 48 . ? 1_555 ? 4 AC1 7 LEU A 50 ? LEU A 50 . ? 1_555 ? 5 AC1 7 CYS A 52 ? CYS A 52 . ? 1_555 ? 6 AC1 7 CYS A 55 ? CYS A 55 . ? 1_555 ? 7 AC1 7 CYS A 92 ? CYS A 92 . ? 1_555 ? # _pdbx_entry_details.entry_id 1L6U _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 11 ? ? H A LEU 19 ? ? 1.49 2 1 H A ILE 12 ? ? O A VAL 105 ? ? 1.50 3 1 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.52 4 1 O A LEU 30 ? ? H A VAL 34 ? ? 1.55 5 1 O A VAL 9 ? ? H A THR 21 ? ? 1.57 6 2 O A PHE 11 ? ? H A LEU 19 ? ? 1.48 7 2 O A GLU 60 ? ? H A PHE 64 ? ? 1.50 8 2 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.51 9 2 H A ASN 13 ? ? O A GLU 17 ? ? 1.53 10 2 H A ILE 12 ? ? O A VAL 105 ? ? 1.56 11 2 H A VAL 9 ? ? O A THR 21 ? ? 1.59 12 3 O A PHE 11 ? ? H A LEU 19 ? ? 1.47 13 3 H A ILE 12 ? ? O A VAL 105 ? ? 1.49 14 3 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.56 15 4 O A PHE 11 ? ? H A LEU 19 ? ? 1.47 16 4 H A VAL 9 ? ? O A THR 21 ? ? 1.49 17 4 O A VAL 9 ? ? H A THR 21 ? ? 1.50 18 4 O A LEU 78 ? ? H A ALA 81 ? ? 1.53 19 4 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.54 20 4 SG A CYS 55 ? ? FE2 A FES 146 ? ? 1.72 21 5 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.48 22 5 O A PHE 11 ? ? H A LEU 19 ? ? 1.48 23 5 H A LEU 57 ? ? O A ARG 89 ? ? 1.51 24 5 O A THR 8 ? ? H A ASN 102 ? ? 1.52 25 5 O A GLU 60 ? ? H A PHE 64 ? ? 1.53 26 5 H A ILE 12 ? ? O A VAL 105 ? ? 1.56 27 5 O A LYS 24 ? ? H A ASP 27 ? ? 1.59 28 6 H A VAL 9 ? ? O A THR 21 ? ? 1.43 29 6 O A PHE 11 ? ? H A LEU 19 ? ? 1.44 30 6 O A ASP 31 ? ? H A GLN 35 ? ? 1.50 31 6 H A HIS 10 ? ? O A MET 103 ? ? 1.53 32 6 O A GLU 60 ? ? H A PHE 64 ? ? 1.53 33 6 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.54 34 6 H A ILE 12 ? ? O A VAL 105 ? ? 1.54 35 6 H A ILE 7 ? ? O A GLY 23 ? ? 1.57 36 6 O A SER 28 ? ? H A ASP 31 ? ? 1.59 37 7 O A PHE 11 ? ? H A LEU 19 ? ? 1.45 38 7 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.48 39 7 O A ASP 31 ? ? H A GLN 35 ? ? 1.53 40 7 O A VAL 9 ? ? H A THR 21 ? ? 1.58 41 7 H A VAL 9 ? ? O A THR 21 ? ? 1.59 42 7 SG A CYS 55 ? ? FE2 A FES 146 ? ? 2.12 43 8 O A PHE 11 ? ? H A LEU 19 ? ? 1.44 44 8 H A ILE 12 ? ? O A VAL 105 ? ? 1.52 45 8 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.54 46 8 O A GLU 60 ? ? H A PHE 64 ? ? 1.55 47 8 O A ASP 31 ? ? H A GLN 35 ? ? 1.57 48 8 H A HIS 10 ? ? O A MET 103 ? ? 1.57 49 8 SG A CYS 55 ? ? FE2 A FES 146 ? ? 1.79 50 9 O A PHE 11 ? ? H A LEU 19 ? ? 1.46 51 9 H A ILE 7 ? ? O A GLY 23 ? ? 1.47 52 9 O A LYS 24 ? ? H A ASP 27 ? ? 1.48 53 9 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.49 54 9 H A ASN 13 ? ? O A GLU 17 ? ? 1.53 55 9 H A ILE 12 ? ? O A VAL 105 ? ? 1.55 56 9 O A ASP 31 ? ? H A GLN 35 ? ? 1.56 57 9 O A ILE 63 ? ? H A LYS 66 ? ? 1.56 58 10 O A PHE 11 ? ? H A LEU 19 ? ? 1.41 59 10 SG A CYS 52 ? ? FE1 A FES 146 ? ? 1.45 60 10 H A VAL 9 ? ? O A THR 21 ? ? 1.47 61 10 H A ILE 12 ? ? O A VAL 105 ? ? 1.60 62 10 SG A CYS 55 ? ? FE2 A FES 146 ? ? 1.91 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -166.25 -72.29 2 1 SER A 3 ? ? 174.76 176.05 3 1 GLU A 4 ? ? -179.83 132.95 4 1 LYS A 6 ? ? -174.90 127.33 5 1 LYS A 24 ? ? 163.37 101.77 6 1 ILE A 25 ? ? -32.66 98.63 7 1 ASP A 27 ? ? -61.47 -152.57 8 1 SER A 28 ? ? -160.05 119.97 9 1 LEU A 29 ? ? -42.01 153.78 10 1 LEU A 30 ? ? 87.70 -52.20 11 1 LEU A 38 ? ? 35.17 88.23 12 1 ASP A 41 ? ? -38.86 104.71 13 1 PHE A 43 ? ? -47.73 177.15 14 1 ALA A 45 ? ? -131.74 -47.71 15 1 GLU A 47 ? ? 86.26 -8.96 16 1 LEU A 50 ? ? 72.78 78.08 17 1 ALA A 51 ? ? -175.11 30.66 18 1 CYS A 52 ? ? -142.54 -46.92 19 1 CYS A 55 ? ? -103.13 -122.55 20 1 HIS A 56 ? ? 61.50 124.77 21 1 HIS A 62 ? ? 82.40 -6.50 22 1 LEU A 84 ? ? -39.88 107.87 23 1 THR A 85 ? ? -76.86 -168.35 24 1 ARG A 87 ? ? -146.09 25.87 25 1 ILE A 94 ? ? 43.29 -161.58 26 1 ASP A 101 ? ? -57.48 96.29 27 1 ASN A 102 ? ? 81.50 37.76 28 2 LYS A 6 ? ? -170.12 136.82 29 2 ASN A 13 ? ? -45.46 164.59 30 2 ILE A 25 ? ? -36.15 104.22 31 2 LEU A 38 ? ? 36.69 87.61 32 2 ASP A 39 ? ? -98.64 37.88 33 2 CYS A 46 ? ? -68.53 3.04 34 2 GLU A 47 ? ? 79.32 -0.85 35 2 LEU A 50 ? ? 68.77 90.25 36 2 ALA A 51 ? ? -173.36 -38.76 37 2 CYS A 55 ? ? -41.38 -76.39 38 2 HIS A 56 ? ? 48.71 -176.12 39 2 LEU A 57 ? ? 169.92 169.75 40 2 GLU A 60 ? ? -38.13 141.79 41 2 ARG A 87 ? ? -140.12 27.79 42 2 ARG A 89 ? ? 175.67 144.56 43 2 CYS A 92 ? ? -141.19 47.66 44 2 GLN A 93 ? ? -176.65 -38.54 45 2 ASP A 101 ? ? 14.43 92.60 46 2 ASN A 102 ? ? 82.00 36.27 47 3 SER A 2 ? ? -164.12 87.84 48 3 GLU A 4 ? ? 179.73 134.65 49 3 ASP A 5 ? ? 162.11 131.59 50 3 LYS A 24 ? ? 176.51 82.30 51 3 ILE A 25 ? ? -18.96 95.57 52 3 ASP A 39 ? ? -113.66 72.53 53 3 ASP A 41 ? ? -67.84 92.31 54 3 PHE A 43 ? ? -21.41 131.40 55 3 GLU A 47 ? ? 88.00 -17.12 56 3 LEU A 50 ? ? 67.28 97.33 57 3 ALA A 51 ? ? 179.92 -34.86 58 3 SER A 53 ? ? -159.88 25.78 59 3 GLN A 61 ? ? -67.67 74.29 60 3 HIS A 62 ? ? 163.95 -30.23 61 3 LEU A 84 ? ? -39.29 116.14 62 3 ARG A 87 ? ? -145.96 26.54 63 3 LEU A 90 ? ? -39.27 147.36 64 3 GLN A 93 ? ? 72.54 -67.53 65 3 ASP A 101 ? ? -66.02 99.86 66 4 ILE A 25 ? ? -36.26 99.87 67 4 PHE A 43 ? ? -36.84 138.44 68 4 GLU A 47 ? ? 85.13 -6.42 69 4 LEU A 50 ? ? 72.40 79.51 70 4 ALA A 51 ? ? -176.19 31.65 71 4 CYS A 52 ? ? -144.84 -45.95 72 4 THR A 54 ? ? -117.93 63.64 73 4 CYS A 55 ? ? -155.30 32.20 74 4 GLU A 60 ? ? -35.78 152.96 75 4 GLN A 61 ? ? -67.68 79.48 76 4 HIS A 62 ? ? 160.25 -27.34 77 4 LEU A 67 ? ? -42.21 163.44 78 4 ALA A 69 ? ? -100.41 -169.41 79 4 LEU A 80 ? ? -39.99 -30.74 80 4 ALA A 81 ? ? -37.56 136.63 81 4 THR A 85 ? ? -101.50 -169.76 82 4 ARG A 87 ? ? -150.58 29.58 83 4 ARG A 89 ? ? -168.45 87.21 84 4 LEU A 90 ? ? 46.57 -169.61 85 4 GLN A 93 ? ? -31.87 -89.12 86 4 ASP A 101 ? ? -5.24 101.03 87 4 ASN A 102 ? ? 79.85 32.84 88 5 SER A 2 ? ? 173.97 174.65 89 5 LYS A 6 ? ? -177.42 117.68 90 5 LYS A 24 ? ? 152.44 92.66 91 5 ILE A 25 ? ? -32.81 97.54 92 5 SER A 28 ? ? -64.75 -84.94 93 5 LEU A 29 ? ? 168.10 -51.94 94 5 ASN A 37 ? ? 84.11 20.40 95 5 LEU A 38 ? ? 36.95 75.42 96 5 ASP A 39 ? ? -98.25 37.34 97 5 PHE A 43 ? ? -40.31 160.26 98 5 ALA A 45 ? ? -162.55 -47.22 99 5 CYS A 46 ? ? -67.60 0.18 100 5 GLU A 47 ? ? 88.30 -18.89 101 5 THR A 49 ? ? -145.83 11.35 102 5 LEU A 50 ? ? 69.08 79.09 103 5 ALA A 51 ? ? -161.82 -43.51 104 5 THR A 54 ? ? -146.34 -45.71 105 5 GLU A 60 ? ? -32.61 143.83 106 5 ALA A 81 ? ? -40.26 153.74 107 5 LEU A 90 ? ? -58.88 -113.21 108 5 GLN A 93 ? ? 166.77 51.94 109 5 ILE A 94 ? ? -174.10 123.27 110 5 ASP A 101 ? ? -19.88 108.93 111 5 ASN A 102 ? ? 90.14 20.72 112 6 LYS A 6 ? ? -173.86 136.08 113 6 ILE A 25 ? ? -34.59 99.03 114 6 SER A 28 ? ? -53.97 100.02 115 6 GLU A 47 ? ? 84.18 -12.71 116 6 LEU A 50 ? ? 81.66 77.94 117 6 ALA A 51 ? ? -170.84 18.11 118 6 SER A 53 ? ? 46.98 29.05 119 6 CYS A 55 ? ? -178.33 48.25 120 6 GLU A 60 ? ? -36.13 146.50 121 6 ALA A 81 ? ? -41.08 156.64 122 6 LEU A 84 ? ? 45.51 78.20 123 6 THR A 85 ? ? -63.13 -173.28 124 6 ARG A 87 ? ? -149.40 27.80 125 6 GLN A 93 ? ? 31.06 44.03 126 6 LEU A 96 ? ? -44.42 159.30 127 6 ASP A 101 ? ? -48.69 106.98 128 7 SER A 2 ? ? 64.90 -78.00 129 7 SER A 3 ? ? -39.97 138.16 130 7 GLU A 4 ? ? -145.63 -62.99 131 7 ASP A 5 ? ? 168.55 161.47 132 7 LYS A 24 ? ? 177.05 83.85 133 7 ILE A 25 ? ? -14.51 109.62 134 7 LEU A 29 ? ? -38.19 -30.91 135 7 ASP A 41 ? ? -86.51 48.90 136 7 PHE A 43 ? ? -97.44 38.27 137 7 LEU A 50 ? ? 70.53 89.62 138 7 ALA A 51 ? ? -166.71 -42.28 139 7 SER A 53 ? ? 88.28 -17.55 140 7 THR A 54 ? ? -88.06 -109.40 141 7 CYS A 55 ? ? 44.32 28.79 142 7 GLU A 60 ? ? -33.61 146.77 143 7 GLN A 61 ? ? -64.93 73.46 144 7 HIS A 62 ? ? 168.94 -31.66 145 7 LEU A 67 ? ? -43.51 158.87 146 7 ASP A 72 ? ? 153.26 -51.80 147 7 ALA A 81 ? ? -38.71 140.75 148 7 LEU A 84 ? ? 45.42 81.53 149 7 THR A 85 ? ? -64.55 -170.47 150 7 ARG A 87 ? ? -150.00 25.26 151 7 ARG A 89 ? ? 178.91 136.54 152 7 LEU A 90 ? ? -39.50 150.55 153 7 GLN A 93 ? ? 73.26 -63.53 154 7 LEU A 96 ? ? -51.39 170.71 155 7 ASP A 101 ? ? -58.77 99.40 156 7 ASN A 102 ? ? 81.63 34.68 157 8 SER A 2 ? ? 70.17 124.13 158 8 SER A 3 ? ? 174.04 122.00 159 8 LYS A 6 ? ? -175.88 125.43 160 8 LYS A 24 ? ? 171.47 69.26 161 8 ILE A 25 ? ? -13.96 90.81 162 8 ASN A 37 ? ? 82.29 18.96 163 8 LEU A 38 ? ? 33.15 86.93 164 8 PHE A 43 ? ? 37.57 -143.40 165 8 GLU A 47 ? ? 83.27 -6.21 166 8 LEU A 50 ? ? 70.00 80.81 167 8 ALA A 51 ? ? -178.31 31.50 168 8 CYS A 52 ? ? -145.01 -46.74 169 8 THR A 54 ? ? -113.59 71.77 170 8 CYS A 55 ? ? -161.64 32.44 171 8 GLU A 60 ? ? -38.18 145.63 172 8 LEU A 80 ? ? -39.38 -35.88 173 8 LEU A 84 ? ? -38.73 117.79 174 8 ARG A 89 ? ? 173.47 135.16 175 8 LEU A 90 ? ? -46.13 -94.27 176 8 CYS A 92 ? ? 49.66 -179.66 177 8 GLN A 93 ? ? 30.57 41.29 178 8 ASN A 102 ? ? 92.87 31.87 179 9 LYS A 6 ? ? -177.97 114.68 180 9 ASN A 13 ? ? -45.53 169.72 181 9 ILE A 25 ? ? -24.06 97.11 182 9 VAL A 32 ? ? -38.97 -35.17 183 9 VAL A 33 ? ? -62.22 -73.11 184 9 LEU A 38 ? ? -43.48 151.73 185 9 ASP A 39 ? ? -104.76 75.70 186 9 ASP A 41 ? ? -38.66 112.61 187 9 PHE A 43 ? ? -36.71 94.75 188 9 ALA A 45 ? ? 163.59 -32.52 189 9 THR A 49 ? ? -168.86 23.34 190 9 LEU A 50 ? ? 58.07 84.14 191 9 ALA A 51 ? ? -168.78 -40.16 192 9 SER A 53 ? ? 63.41 63.12 193 9 THR A 54 ? ? -157.61 -43.21 194 9 HIS A 56 ? ? -170.96 140.37 195 9 GLU A 60 ? ? -34.09 149.93 196 9 GLN A 61 ? ? -65.65 75.80 197 9 HIS A 62 ? ? 172.14 -34.08 198 9 ALA A 81 ? ? -40.36 156.36 199 9 LEU A 84 ? ? 41.33 82.58 200 9 ARG A 89 ? ? -153.42 53.62 201 9 LEU A 90 ? ? 38.84 -108.80 202 9 LEU A 96 ? ? -41.34 158.12 203 9 ASP A 101 ? ? -59.83 100.55 204 9 ASN A 102 ? ? 74.18 41.17 205 10 ASP A 5 ? ? -164.56 110.67 206 10 LYS A 6 ? ? -178.16 135.28 207 10 LYS A 24 ? ? -176.26 77.06 208 10 ILE A 25 ? ? -13.00 92.33 209 10 LEU A 38 ? ? 36.40 76.72 210 10 ASP A 39 ? ? -91.96 31.18 211 10 ILE A 40 ? ? -140.66 57.57 212 10 ASP A 41 ? ? -39.49 114.22 213 10 PHE A 43 ? ? -52.00 107.58 214 10 THR A 49 ? ? -169.69 25.81 215 10 LEU A 50 ? ? 53.73 88.74 216 10 ALA A 51 ? ? -174.87 -38.68 217 10 GLU A 60 ? ? -35.55 134.92 218 10 LYS A 66 ? ? -155.36 29.03 219 10 THR A 71 ? ? -110.05 -168.30 220 10 LEU A 80 ? ? -86.96 34.27 221 10 LEU A 84 ? ? -37.60 98.63 222 10 ARG A 87 ? ? -149.63 24.73 223 10 GLN A 93 ? ? -120.19 -133.16 224 10 ILE A 94 ? ? 46.98 -162.46 225 10 ASN A 102 ? ? 91.09 24.86 # _pdbx_nmr_ensemble.entry_id 1L6U _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1L6U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2-3mM Adrenodoxin 15N,13C, 50 mM phosphate buffer, 50mM NaCl, 10% D2O, 0.04% NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM salt' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_details.entry_id 1L6U _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1L6U _pdbx_nmr_refine.method 'distance geometry, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 1.1 processing Bruker 1 DYANA 1.5 'structure solution' Guentert 2 nmr2st 1.0 'data analysis' Pristovsek 3 DYANA 1.5 refinement Guentert 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 109 ? A ASP 109 2 1 Y 1 A ALA 110 ? A ALA 110 3 1 Y 1 A VAL 111 ? A VAL 111 4 1 Y 1 A SER 112 ? A SER 112 5 1 Y 1 A ASP 113 ? A ASP 113 6 1 Y 1 A ALA 114 ? A ALA 114 7 1 Y 1 A ARG 115 ? A ARG 115 8 1 Y 1 A GLU 116 ? A GLU 116 9 1 Y 1 A SER 117 ? A SER 117 10 1 Y 1 A ILE 118 ? A ILE 118 11 1 Y 1 A ASP 119 ? A ASP 119 12 1 Y 1 A MET 120 ? A MET 120 13 1 Y 1 A GLY 121 ? A GLY 121 14 1 Y 1 A MET 122 ? A MET 122 15 1 Y 1 A ASN 123 ? A ASN 123 16 1 Y 1 A SER 124 ? A SER 124 17 1 Y 1 A SER 125 ? A SER 125 18 1 Y 1 A LYS 126 ? A LYS 126 19 1 Y 1 A ILE 127 ? A ILE 127 20 1 Y 1 A GLU 128 ? A GLU 128 21 2 Y 1 A ASP 109 ? A ASP 109 22 2 Y 1 A ALA 110 ? A ALA 110 23 2 Y 1 A VAL 111 ? A VAL 111 24 2 Y 1 A SER 112 ? A SER 112 25 2 Y 1 A ASP 113 ? A ASP 113 26 2 Y 1 A ALA 114 ? A ALA 114 27 2 Y 1 A ARG 115 ? A ARG 115 28 2 Y 1 A GLU 116 ? A GLU 116 29 2 Y 1 A SER 117 ? A SER 117 30 2 Y 1 A ILE 118 ? A ILE 118 31 2 Y 1 A ASP 119 ? A ASP 119 32 2 Y 1 A MET 120 ? A MET 120 33 2 Y 1 A GLY 121 ? A GLY 121 34 2 Y 1 A MET 122 ? A MET 122 35 2 Y 1 A ASN 123 ? A ASN 123 36 2 Y 1 A SER 124 ? A SER 124 37 2 Y 1 A SER 125 ? A SER 125 38 2 Y 1 A LYS 126 ? A LYS 126 39 2 Y 1 A ILE 127 ? A ILE 127 40 2 Y 1 A GLU 128 ? A GLU 128 41 3 Y 1 A ASP 109 ? A ASP 109 42 3 Y 1 A ALA 110 ? A ALA 110 43 3 Y 1 A VAL 111 ? A VAL 111 44 3 Y 1 A SER 112 ? A SER 112 45 3 Y 1 A ASP 113 ? A ASP 113 46 3 Y 1 A ALA 114 ? A ALA 114 47 3 Y 1 A ARG 115 ? A ARG 115 48 3 Y 1 A GLU 116 ? A GLU 116 49 3 Y 1 A SER 117 ? A SER 117 50 3 Y 1 A ILE 118 ? A ILE 118 51 3 Y 1 A ASP 119 ? A ASP 119 52 3 Y 1 A MET 120 ? A MET 120 53 3 Y 1 A GLY 121 ? A GLY 121 54 3 Y 1 A MET 122 ? A MET 122 55 3 Y 1 A ASN 123 ? A ASN 123 56 3 Y 1 A SER 124 ? A SER 124 57 3 Y 1 A SER 125 ? A SER 125 58 3 Y 1 A LYS 126 ? A LYS 126 59 3 Y 1 A ILE 127 ? A ILE 127 60 3 Y 1 A GLU 128 ? A GLU 128 61 4 Y 1 A ASP 109 ? A ASP 109 62 4 Y 1 A ALA 110 ? A ALA 110 63 4 Y 1 A VAL 111 ? A VAL 111 64 4 Y 1 A SER 112 ? A SER 112 65 4 Y 1 A ASP 113 ? A ASP 113 66 4 Y 1 A ALA 114 ? A ALA 114 67 4 Y 1 A ARG 115 ? A ARG 115 68 4 Y 1 A GLU 116 ? A GLU 116 69 4 Y 1 A SER 117 ? A SER 117 70 4 Y 1 A ILE 118 ? A ILE 118 71 4 Y 1 A ASP 119 ? A ASP 119 72 4 Y 1 A MET 120 ? A MET 120 73 4 Y 1 A GLY 121 ? A GLY 121 74 4 Y 1 A MET 122 ? A MET 122 75 4 Y 1 A ASN 123 ? A ASN 123 76 4 Y 1 A SER 124 ? A SER 124 77 4 Y 1 A SER 125 ? A SER 125 78 4 Y 1 A LYS 126 ? A LYS 126 79 4 Y 1 A ILE 127 ? A ILE 127 80 4 Y 1 A GLU 128 ? A GLU 128 81 5 Y 1 A ASP 109 ? A ASP 109 82 5 Y 1 A ALA 110 ? A ALA 110 83 5 Y 1 A VAL 111 ? A VAL 111 84 5 Y 1 A SER 112 ? A SER 112 85 5 Y 1 A ASP 113 ? A ASP 113 86 5 Y 1 A ALA 114 ? A ALA 114 87 5 Y 1 A ARG 115 ? A ARG 115 88 5 Y 1 A GLU 116 ? A GLU 116 89 5 Y 1 A SER 117 ? A SER 117 90 5 Y 1 A ILE 118 ? A ILE 118 91 5 Y 1 A ASP 119 ? A ASP 119 92 5 Y 1 A MET 120 ? A MET 120 93 5 Y 1 A GLY 121 ? A GLY 121 94 5 Y 1 A MET 122 ? A MET 122 95 5 Y 1 A ASN 123 ? A ASN 123 96 5 Y 1 A SER 124 ? A SER 124 97 5 Y 1 A SER 125 ? A SER 125 98 5 Y 1 A LYS 126 ? A LYS 126 99 5 Y 1 A ILE 127 ? A ILE 127 100 5 Y 1 A GLU 128 ? A GLU 128 101 6 Y 1 A ASP 109 ? A ASP 109 102 6 Y 1 A ALA 110 ? A ALA 110 103 6 Y 1 A VAL 111 ? A VAL 111 104 6 Y 1 A SER 112 ? A SER 112 105 6 Y 1 A ASP 113 ? A ASP 113 106 6 Y 1 A ALA 114 ? A ALA 114 107 6 Y 1 A ARG 115 ? A ARG 115 108 6 Y 1 A GLU 116 ? A GLU 116 109 6 Y 1 A SER 117 ? A SER 117 110 6 Y 1 A ILE 118 ? A ILE 118 111 6 Y 1 A ASP 119 ? A ASP 119 112 6 Y 1 A MET 120 ? A MET 120 113 6 Y 1 A GLY 121 ? A GLY 121 114 6 Y 1 A MET 122 ? A MET 122 115 6 Y 1 A ASN 123 ? A ASN 123 116 6 Y 1 A SER 124 ? A SER 124 117 6 Y 1 A SER 125 ? A SER 125 118 6 Y 1 A LYS 126 ? A LYS 126 119 6 Y 1 A ILE 127 ? A ILE 127 120 6 Y 1 A GLU 128 ? A GLU 128 121 7 Y 1 A ASP 109 ? A ASP 109 122 7 Y 1 A ALA 110 ? A ALA 110 123 7 Y 1 A VAL 111 ? A VAL 111 124 7 Y 1 A SER 112 ? A SER 112 125 7 Y 1 A ASP 113 ? A ASP 113 126 7 Y 1 A ALA 114 ? A ALA 114 127 7 Y 1 A ARG 115 ? A ARG 115 128 7 Y 1 A GLU 116 ? A GLU 116 129 7 Y 1 A SER 117 ? A SER 117 130 7 Y 1 A ILE 118 ? A ILE 118 131 7 Y 1 A ASP 119 ? A ASP 119 132 7 Y 1 A MET 120 ? A MET 120 133 7 Y 1 A GLY 121 ? A GLY 121 134 7 Y 1 A MET 122 ? A MET 122 135 7 Y 1 A ASN 123 ? A ASN 123 136 7 Y 1 A SER 124 ? A SER 124 137 7 Y 1 A SER 125 ? A SER 125 138 7 Y 1 A LYS 126 ? A LYS 126 139 7 Y 1 A ILE 127 ? A ILE 127 140 7 Y 1 A GLU 128 ? A GLU 128 141 8 Y 1 A ASP 109 ? A ASP 109 142 8 Y 1 A ALA 110 ? A ALA 110 143 8 Y 1 A VAL 111 ? A VAL 111 144 8 Y 1 A SER 112 ? A SER 112 145 8 Y 1 A ASP 113 ? A ASP 113 146 8 Y 1 A ALA 114 ? A ALA 114 147 8 Y 1 A ARG 115 ? A ARG 115 148 8 Y 1 A GLU 116 ? A GLU 116 149 8 Y 1 A SER 117 ? A SER 117 150 8 Y 1 A ILE 118 ? A ILE 118 151 8 Y 1 A ASP 119 ? A ASP 119 152 8 Y 1 A MET 120 ? A MET 120 153 8 Y 1 A GLY 121 ? A GLY 121 154 8 Y 1 A MET 122 ? A MET 122 155 8 Y 1 A ASN 123 ? A ASN 123 156 8 Y 1 A SER 124 ? A SER 124 157 8 Y 1 A SER 125 ? A SER 125 158 8 Y 1 A LYS 126 ? A LYS 126 159 8 Y 1 A ILE 127 ? A ILE 127 160 8 Y 1 A GLU 128 ? A GLU 128 161 9 Y 1 A ASP 109 ? A ASP 109 162 9 Y 1 A ALA 110 ? A ALA 110 163 9 Y 1 A VAL 111 ? A VAL 111 164 9 Y 1 A SER 112 ? A SER 112 165 9 Y 1 A ASP 113 ? A ASP 113 166 9 Y 1 A ALA 114 ? A ALA 114 167 9 Y 1 A ARG 115 ? A ARG 115 168 9 Y 1 A GLU 116 ? A GLU 116 169 9 Y 1 A SER 117 ? A SER 117 170 9 Y 1 A ILE 118 ? A ILE 118 171 9 Y 1 A ASP 119 ? A ASP 119 172 9 Y 1 A MET 120 ? A MET 120 173 9 Y 1 A GLY 121 ? A GLY 121 174 9 Y 1 A MET 122 ? A MET 122 175 9 Y 1 A ASN 123 ? A ASN 123 176 9 Y 1 A SER 124 ? A SER 124 177 9 Y 1 A SER 125 ? A SER 125 178 9 Y 1 A LYS 126 ? A LYS 126 179 9 Y 1 A ILE 127 ? A ILE 127 180 9 Y 1 A GLU 128 ? A GLU 128 181 10 Y 1 A ASP 109 ? A ASP 109 182 10 Y 1 A ALA 110 ? A ALA 110 183 10 Y 1 A VAL 111 ? A VAL 111 184 10 Y 1 A SER 112 ? A SER 112 185 10 Y 1 A ASP 113 ? A ASP 113 186 10 Y 1 A ALA 114 ? A ALA 114 187 10 Y 1 A ARG 115 ? A ARG 115 188 10 Y 1 A GLU 116 ? A GLU 116 189 10 Y 1 A SER 117 ? A SER 117 190 10 Y 1 A ILE 118 ? A ILE 118 191 10 Y 1 A ASP 119 ? A ASP 119 192 10 Y 1 A MET 120 ? A MET 120 193 10 Y 1 A GLY 121 ? A GLY 121 194 10 Y 1 A MET 122 ? A MET 122 195 10 Y 1 A ASN 123 ? A ASN 123 196 10 Y 1 A SER 124 ? A SER 124 197 10 Y 1 A SER 125 ? A SER 125 198 10 Y 1 A LYS 126 ? A LYS 126 199 10 Y 1 A ILE 127 ? A ILE 127 200 10 Y 1 A GLU 128 ? A GLU 128 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FES FE1 FE N N 88 FES FE2 FE N N 89 FES S1 S N N 90 FES S2 S N N 91 GLN N N N N 92 GLN CA C N S 93 GLN C C N N 94 GLN O O N N 95 GLN CB C N N 96 GLN CG C N N 97 GLN CD C N N 98 GLN OE1 O N N 99 GLN NE2 N N N 100 GLN OXT O N N 101 GLN H H N N 102 GLN H2 H N N 103 GLN HA H N N 104 GLN HB2 H N N 105 GLN HB3 H N N 106 GLN HG2 H N N 107 GLN HG3 H N N 108 GLN HE21 H N N 109 GLN HE22 H N N 110 GLN HXT H N N 111 GLU N N N N 112 GLU CA C N S 113 GLU C C N N 114 GLU O O N N 115 GLU CB C N N 116 GLU CG C N N 117 GLU CD C N N 118 GLU OE1 O N N 119 GLU OE2 O N N 120 GLU OXT O N N 121 GLU H H N N 122 GLU H2 H N N 123 GLU HA H N N 124 GLU HB2 H N N 125 GLU HB3 H N N 126 GLU HG2 H N N 127 GLU HG3 H N N 128 GLU HE2 H N N 129 GLU HXT H N N 130 GLY N N N N 131 GLY CA C N N 132 GLY C C N N 133 GLY O O N N 134 GLY OXT O N N 135 GLY H H N N 136 GLY H2 H N N 137 GLY HA2 H N N 138 GLY HA3 H N N 139 GLY HXT H N N 140 HIS N N N N 141 HIS CA C N S 142 HIS C C N N 143 HIS O O N N 144 HIS CB C N N 145 HIS CG C Y N 146 HIS ND1 N Y N 147 HIS CD2 C Y N 148 HIS CE1 C Y N 149 HIS NE2 N Y N 150 HIS OXT O N N 151 HIS H H N N 152 HIS H2 H N N 153 HIS HA H N N 154 HIS HB2 H N N 155 HIS HB3 H N N 156 HIS HD1 H N N 157 HIS HD2 H N N 158 HIS HE1 H N N 159 HIS HE2 H N N 160 HIS HXT H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TYR N N N N 322 TYR CA C N S 323 TYR C C N N 324 TYR O O N N 325 TYR CB C N N 326 TYR CG C Y N 327 TYR CD1 C Y N 328 TYR CD2 C Y N 329 TYR CE1 C Y N 330 TYR CE2 C Y N 331 TYR CZ C Y N 332 TYR OH O N N 333 TYR OXT O N N 334 TYR H H N N 335 TYR H2 H N N 336 TYR HA H N N 337 TYR HB2 H N N 338 TYR HB3 H N N 339 TYR HD1 H N N 340 TYR HD2 H N N 341 TYR HE1 H N N 342 TYR HE2 H N N 343 TYR HH H N N 344 TYR HXT H N N 345 VAL N N N N 346 VAL CA C N S 347 VAL C C N N 348 VAL O O N N 349 VAL CB C N N 350 VAL CG1 C N N 351 VAL CG2 C N N 352 VAL OXT O N N 353 VAL H H N N 354 VAL H2 H N N 355 VAL HA H N N 356 VAL HB H N N 357 VAL HG11 H N N 358 VAL HG12 H N N 359 VAL HG13 H N N 360 VAL HG21 H N N 361 VAL HG22 H N N 362 VAL HG23 H N N 363 VAL HXT H N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 ILE N CA sing N N 154 ILE N H sing N N 155 ILE N H2 sing N N 156 ILE CA C sing N N 157 ILE CA CB sing N N 158 ILE CA HA sing N N 159 ILE C O doub N N 160 ILE C OXT sing N N 161 ILE CB CG1 sing N N 162 ILE CB CG2 sing N N 163 ILE CB HB sing N N 164 ILE CG1 CD1 sing N N 165 ILE CG1 HG12 sing N N 166 ILE CG1 HG13 sing N N 167 ILE CG2 HG21 sing N N 168 ILE CG2 HG22 sing N N 169 ILE CG2 HG23 sing N N 170 ILE CD1 HD11 sing N N 171 ILE CD1 HD12 sing N N 172 ILE CD1 HD13 sing N N 173 ILE OXT HXT sing N N 174 LEU N CA sing N N 175 LEU N H sing N N 176 LEU N H2 sing N N 177 LEU CA C sing N N 178 LEU CA CB sing N N 179 LEU CA HA sing N N 180 LEU C O doub N N 181 LEU C OXT sing N N 182 LEU CB CG sing N N 183 LEU CB HB2 sing N N 184 LEU CB HB3 sing N N 185 LEU CG CD1 sing N N 186 LEU CG CD2 sing N N 187 LEU CG HG sing N N 188 LEU CD1 HD11 sing N N 189 LEU CD1 HD12 sing N N 190 LEU CD1 HD13 sing N N 191 LEU CD2 HD21 sing N N 192 LEU CD2 HD22 sing N N 193 LEU CD2 HD23 sing N N 194 LEU OXT HXT sing N N 195 LYS N CA sing N N 196 LYS N H sing N N 197 LYS N H2 sing N N 198 LYS CA C sing N N 199 LYS CA CB sing N N 200 LYS CA HA sing N N 201 LYS C O doub N N 202 LYS C OXT sing N N 203 LYS CB CG sing N N 204 LYS CB HB2 sing N N 205 LYS CB HB3 sing N N 206 LYS CG CD sing N N 207 LYS CG HG2 sing N N 208 LYS CG HG3 sing N N 209 LYS CD CE sing N N 210 LYS CD HD2 sing N N 211 LYS CD HD3 sing N N 212 LYS CE NZ sing N N 213 LYS CE HE2 sing N N 214 LYS CE HE3 sing N N 215 LYS NZ HZ1 sing N N 216 LYS NZ HZ2 sing N N 217 LYS NZ HZ3 sing N N 218 LYS OXT HXT sing N N 219 MET N CA sing N N 220 MET N H sing N N 221 MET N H2 sing N N 222 MET CA C sing N N 223 MET CA CB sing N N 224 MET CA HA sing N N 225 MET C O doub N N 226 MET C OXT sing N N 227 MET CB CG sing N N 228 MET CB HB2 sing N N 229 MET CB HB3 sing N N 230 MET CG SD sing N N 231 MET CG HG2 sing N N 232 MET CG HG3 sing N N 233 MET SD CE sing N N 234 MET CE HE1 sing N N 235 MET CE HE2 sing N N 236 MET CE HE3 sing N N 237 MET OXT HXT sing N N 238 PHE N CA sing N N 239 PHE N H sing N N 240 PHE N H2 sing N N 241 PHE CA C sing N N 242 PHE CA CB sing N N 243 PHE CA HA sing N N 244 PHE C O doub N N 245 PHE C OXT sing N N 246 PHE CB CG sing N N 247 PHE CB HB2 sing N N 248 PHE CB HB3 sing N N 249 PHE CG CD1 doub Y N 250 PHE CG CD2 sing Y N 251 PHE CD1 CE1 sing Y N 252 PHE CD1 HD1 sing N N 253 PHE CD2 CE2 doub Y N 254 PHE CD2 HD2 sing N N 255 PHE CE1 CZ doub Y N 256 PHE CE1 HE1 sing N N 257 PHE CE2 CZ sing Y N 258 PHE CE2 HE2 sing N N 259 PHE CZ HZ sing N N 260 PHE OXT HXT sing N N 261 PRO N CA sing N N 262 PRO N CD sing N N 263 PRO N H sing N N 264 PRO CA C sing N N 265 PRO CA CB sing N N 266 PRO CA HA sing N N 267 PRO C O doub N N 268 PRO C OXT sing N N 269 PRO CB CG sing N N 270 PRO CB HB2 sing N N 271 PRO CB HB3 sing N N 272 PRO CG CD sing N N 273 PRO CG HG2 sing N N 274 PRO CG HG3 sing N N 275 PRO CD HD2 sing N N 276 PRO CD HD3 sing N N 277 PRO OXT HXT sing N N 278 SER N CA sing N N 279 SER N H sing N N 280 SER N H2 sing N N 281 SER CA C sing N N 282 SER CA CB sing N N 283 SER CA HA sing N N 284 SER C O doub N N 285 SER C OXT sing N N 286 SER CB OG sing N N 287 SER CB HB2 sing N N 288 SER CB HB3 sing N N 289 SER OG HG sing N N 290 SER OXT HXT sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TYR N CA sing N N 308 TYR N H sing N N 309 TYR N H2 sing N N 310 TYR CA C sing N N 311 TYR CA CB sing N N 312 TYR CA HA sing N N 313 TYR C O doub N N 314 TYR C OXT sing N N 315 TYR CB CG sing N N 316 TYR CB HB2 sing N N 317 TYR CB HB3 sing N N 318 TYR CG CD1 doub Y N 319 TYR CG CD2 sing Y N 320 TYR CD1 CE1 sing Y N 321 TYR CD1 HD1 sing N N 322 TYR CD2 CE2 doub Y N 323 TYR CD2 HD2 sing N N 324 TYR CE1 CZ doub Y N 325 TYR CE1 HE1 sing N N 326 TYR CE2 CZ sing Y N 327 TYR CE2 HE2 sing N N 328 TYR CZ OH sing N N 329 TYR OH HH sing N N 330 TYR OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 600 2 ? Bruker DMX 500 # _atom_sites.entry_id 1L6U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE H N O S # loop_