data_1L7B # _entry.id 1L7B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1L7B pdb_00001l7b 10.2210/pdb1l7b/pdb RCSB RCSB015705 ? ? WWPDB D_1000015705 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-09-16 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1L7B _pdbx_database_status.recvd_initial_deposition_date 2002-03-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id WR64Tt _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sahota, G.' 1 'Dixon, B.L.' 2 'Huang, Y.P.' 3 'Aramini, J.' 4 'Monleon, D.' 5 'Bhattacharya, D.' 6 'Swapna, G.V.T.' 7 'Yin, C.' 8 'Xiao, R.' 9 'Anderson, S.' 10 'Tejero, R.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Solution NMR Structure of the Brct Domain from Thermus Thermophilus DNA Ligase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sahota, G.' 1 ? primary 'Dixon, B.L.' 2 ? primary 'Huang, Y.P.' 3 ? primary 'Aramini, J.' 4 ? primary 'Bhattacharya, A.' 5 ? primary 'Monleon, D.' 6 ? primary 'Swapna, G.V.T.' 7 ? primary 'Yin, C.' 8 ? primary 'Xiao, R.' 9 ? primary 'Anderson, S.' 10 ? primary 'Montelione, G.T.' 11 ? primary 'Tejero, R.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA LIGASE' _entity.formula_weight 10030.583 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.5.1.2 _entity.pdbx_mutation ? _entity.pdbx_fragment 'BRCT DOMAIN' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEKGGEALKGLTFVITGELSRPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVPTLTEEELYRLLEA RTGKKAEELVGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MEKGGEALKGLTFVITGELSRPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVPTLTEEELYRLLEA RTGKKAEELVGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier WR64Tt # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 LYS n 1 4 GLY n 1 5 GLY n 1 6 GLU n 1 7 ALA n 1 8 LEU n 1 9 LYS n 1 10 GLY n 1 11 LEU n 1 12 THR n 1 13 PHE n 1 14 VAL n 1 15 ILE n 1 16 THR n 1 17 GLY n 1 18 GLU n 1 19 LEU n 1 20 SER n 1 21 ARG n 1 22 PRO n 1 23 ARG n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 LYS n 1 28 ALA n 1 29 LEU n 1 30 LEU n 1 31 ARG n 1 32 ARG n 1 33 LEU n 1 34 GLY n 1 35 ALA n 1 36 LYS n 1 37 VAL n 1 38 THR n 1 39 ASP n 1 40 SER n 1 41 VAL n 1 42 SER n 1 43 ARG n 1 44 LYS n 1 45 THR n 1 46 SER n 1 47 TYR n 1 48 LEU n 1 49 VAL n 1 50 VAL n 1 51 GLY n 1 52 GLU n 1 53 ASN n 1 54 PRO n 1 55 GLY n 1 56 SER n 1 57 LYS n 1 58 LEU n 1 59 GLU n 1 60 LYS n 1 61 ALA n 1 62 ARG n 1 63 ALA n 1 64 LEU n 1 65 GLY n 1 66 VAL n 1 67 PRO n 1 68 THR n 1 69 LEU n 1 70 THR n 1 71 GLU n 1 72 GLU n 1 73 GLU n 1 74 LEU n 1 75 TYR n 1 76 ARG n 1 77 LEU n 1 78 LEU n 1 79 GLU n 1 80 ALA n 1 81 ARG n 1 82 THR n 1 83 GLY n 1 84 LYS n 1 85 LYS n 1 86 ALA n 1 87 GLU n 1 88 GLU n 1 89 LEU n 1 90 VAL n 1 91 GLY n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermus _entity_src_gen.pdbx_gene_src_gene DNLJ _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 274 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 SER 92 92 92 SER SER A . n # _cell.entry_id 1L7B _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1L7B _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1L7B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1L7B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1L7B _struct.title 'Solution NMR Structure of BRCT Domain of T. Thermophilus: Northeast Structural Genomics Consortium Target WR64TT' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1L7B _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;BRCT, DNA LIGASE, AUTOSTRUCTURE, STRUCTURAL GENOMICS, NESG, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, LIGASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNLJ_THET8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKGGEALKGLTFVITGELSRPREEVKALLRRLGAKVTDSVSRKTSYLVVGENPGSKLEKARALGVPTLTEEELYRLLEAR TGKKAEELV ; _struct_ref.pdbx_align_begin 588 _struct_ref.pdbx_db_accession P26996 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1L7B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P26996 _struct_ref_seq.db_align_beg 588 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 676 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1L7B MET A 1 ? UNP P26996 ? ? 'SEE REMARK 999' 1 1 1 1L7B GLY A 91 ? UNP P26996 ? ? 'SEE REMARK 999' 91 2 1 1L7B SER A 92 ? UNP P26996 ? ? 'SEE REMARK 999' 92 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A1 ARG A 23 ? ARG A 31 ? ARG A 23 ARG A 31 1 ? 9 HELX_P HELX_P2 A2 LYS A 57 ? ALA A 63 ? LYS A 57 ALA A 63 1 ? 7 HELX_P HELX_P3 A3 GLU A 71 ? GLY A 83 ? GLU A 71 GLY A 83 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id S1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense S1 1 2 ? parallel S1 2 3 ? parallel S1 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id S1 1 ALA A 35 ? THR A 38 ? ALA A 35 THR A 38 S1 2 LEU A 11 ? ILE A 15 ? LEU A 11 ILE A 15 S1 3 TYR A 47 ? VAL A 50 ? TYR A 47 VAL A 50 S1 4 THR A 68 ? THR A 70 ? THR A 68 THR A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id S1 1 2 O PHE A 13 ? O PHE A 13 N THR A 38 ? N THR A 38 S1 2 3 O VAL A 14 ? O VAL A 14 N VAL A 49 ? N VAL A 49 S1 3 4 N LEU A 69 ? N LEU A 69 O LEU A 48 ? O LEU A 48 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 57 ? ? H A ALA 61 ? ? 1.46 2 1 O A THR 45 ? ? HG A SER 46 ? ? 1.55 3 1 O A LEU 78 ? ? H A THR 82 ? ? 1.56 4 2 O A LYS 57 ? ? H A ALA 61 ? ? 1.54 5 5 O A LYS 57 ? ? H A ALA 61 ? ? 1.57 6 6 O A LYS 57 ? ? H A ALA 61 ? ? 1.52 7 9 O A LYS 57 ? ? H A ALA 61 ? ? 1.53 8 10 O A LYS 57 ? ? H A ALA 61 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 6 ? ? -151.15 26.22 2 1 ALA A 7 ? ? -42.09 -85.44 3 1 GLU A 18 ? ? -146.55 -0.95 4 1 LEU A 19 ? ? 67.53 -14.77 5 1 SER A 20 ? ? 88.82 33.30 6 1 PRO A 22 ? ? -65.13 94.53 7 1 ASP A 39 ? ? -156.79 28.52 8 1 SER A 42 ? ? -139.36 -32.16 9 1 ARG A 43 ? ? 165.35 -63.61 10 1 THR A 45 ? ? -81.74 -108.83 11 1 GLU A 52 ? ? -65.99 -172.36 12 1 ALA A 63 ? ? 41.74 116.42 13 1 LEU A 64 ? ? -86.70 31.66 14 1 ARG A 76 ? ? -70.03 -76.29 15 1 LEU A 89 ? ? -161.04 -125.50 16 1 VAL A 90 ? ? 63.77 -82.00 17 2 GLU A 6 ? ? -175.32 -65.78 18 2 ALA A 7 ? ? 79.98 -90.97 19 2 LYS A 9 ? ? -47.04 172.60 20 2 THR A 16 ? ? -56.56 1.00 21 2 GLU A 18 ? ? 176.84 28.47 22 2 SER A 20 ? ? 89.52 34.74 23 2 PRO A 22 ? ? -70.95 36.76 24 2 ARG A 23 ? ? -43.07 -14.81 25 2 ASP A 39 ? ? -146.63 -0.69 26 2 SER A 42 ? ? -152.40 -31.65 27 2 ARG A 43 ? ? -178.20 -70.99 28 2 SER A 46 ? ? -151.65 65.10 29 2 VAL A 50 ? ? -64.22 93.65 30 2 GLU A 52 ? ? -67.51 -164.48 31 2 ALA A 63 ? ? 63.14 149.83 32 2 ARG A 76 ? ? -67.65 -72.10 33 2 LEU A 78 ? ? -58.79 -75.09 34 2 LYS A 85 ? ? -69.97 99.85 35 2 GLU A 88 ? ? 58.63 11.34 36 3 GLU A 6 ? ? -141.27 33.82 37 3 ALA A 7 ? ? 79.13 -43.64 38 3 LYS A 9 ? ? -46.18 175.18 39 3 THR A 16 ? ? -68.81 80.46 40 3 SER A 20 ? ? 87.44 21.04 41 3 PRO A 22 ? ? -69.24 36.01 42 3 ARG A 23 ? ? -45.77 -15.46 43 3 LEU A 33 ? ? -69.88 8.23 44 3 THR A 38 ? ? -164.25 -168.93 45 3 SER A 42 ? ? -139.00 -55.04 46 3 ARG A 43 ? ? -175.75 22.02 47 3 LYS A 44 ? ? -169.30 24.50 48 3 THR A 45 ? ? -151.57 35.18 49 3 GLU A 52 ? ? -114.12 -134.75 50 3 ASN A 53 ? ? -122.49 -64.02 51 3 ALA A 63 ? ? 60.42 150.46 52 3 ARG A 76 ? ? -65.21 -74.38 53 4 GLU A 2 ? ? 58.81 -85.07 54 4 GLU A 6 ? ? 165.55 -39.09 55 4 ALA A 7 ? ? -37.15 -78.42 56 4 LYS A 9 ? ? -51.37 178.00 57 4 THR A 16 ? ? -69.29 97.96 58 4 GLU A 18 ? ? 83.82 113.23 59 4 LEU A 19 ? ? -76.11 -163.08 60 4 ARG A 23 ? ? -41.84 -14.69 61 4 LEU A 33 ? ? -67.40 10.58 62 4 ASP A 39 ? ? -149.21 -1.81 63 4 SER A 42 ? ? -145.16 -38.30 64 4 ARG A 43 ? ? 174.56 -64.71 65 4 VAL A 50 ? ? -49.28 166.68 66 4 GLU A 52 ? ? -100.24 -125.50 67 4 ASN A 53 ? ? -121.99 -64.97 68 4 ALA A 63 ? ? 58.02 155.24 69 4 ARG A 76 ? ? -63.14 -74.97 70 4 LYS A 85 ? ? -61.39 97.95 71 4 LEU A 89 ? ? -136.68 -32.47 72 5 GLU A 2 ? ? -159.21 -30.22 73 5 GLU A 6 ? ? -161.96 -59.15 74 5 ALA A 7 ? ? 72.86 -110.88 75 5 GLU A 18 ? ? 81.97 114.06 76 5 LEU A 19 ? ? -73.46 -166.39 77 5 SER A 20 ? ? -98.04 53.13 78 5 PRO A 22 ? ? -67.94 38.66 79 5 ARG A 23 ? ? -44.57 -11.03 80 5 LEU A 33 ? ? -63.77 12.22 81 5 THR A 38 ? ? -161.73 -169.48 82 5 ASP A 39 ? ? -150.67 -8.68 83 5 SER A 42 ? ? -140.58 -45.69 84 5 ARG A 43 ? ? -177.64 -65.96 85 5 SER A 46 ? ? -165.61 33.02 86 5 GLU A 52 ? ? -81.54 -133.91 87 5 ALA A 63 ? ? 38.09 99.58 88 5 LEU A 64 ? ? -84.26 32.26 89 5 ARG A 76 ? ? -64.61 -75.78 90 5 LEU A 78 ? ? -69.39 -70.00 91 5 LYS A 85 ? ? -60.85 96.26 92 5 GLU A 88 ? ? 55.40 -96.33 93 5 VAL A 90 ? ? 64.66 103.59 94 6 GLU A 6 ? ? -136.79 -85.57 95 6 ALA A 7 ? ? 86.37 -87.55 96 6 LYS A 9 ? ? -46.81 174.45 97 6 THR A 16 ? ? -64.64 83.78 98 6 SER A 20 ? ? 86.77 36.62 99 6 PRO A 22 ? ? -71.55 41.29 100 6 ARG A 23 ? ? -42.72 -16.50 101 6 THR A 38 ? ? -172.61 -168.84 102 6 ASP A 39 ? ? -151.42 4.07 103 6 SER A 42 ? ? -142.90 -42.18 104 6 ARG A 43 ? ? 178.37 -67.17 105 6 GLU A 52 ? ? -78.57 -159.57 106 6 ASN A 53 ? ? -122.98 -66.74 107 6 ALA A 63 ? ? 62.13 147.92 108 6 ARG A 76 ? ? -61.89 -75.59 109 6 LEU A 78 ? ? -55.87 -74.14 110 6 GLU A 88 ? ? 153.55 -101.18 111 6 LEU A 89 ? ? -46.61 -95.35 112 6 VAL A 90 ? ? 169.49 145.96 113 7 GLU A 2 ? ? -155.52 -135.97 114 7 ALA A 7 ? ? -37.87 -84.25 115 7 LYS A 9 ? ? -47.81 173.37 116 7 THR A 16 ? ? -57.26 -1.64 117 7 GLU A 18 ? ? 148.18 69.76 118 7 SER A 20 ? ? 85.56 24.72 119 7 PRO A 22 ? ? -67.15 39.83 120 7 ARG A 23 ? ? -43.47 -13.73 121 7 ASP A 39 ? ? -150.57 -0.19 122 7 SER A 42 ? ? -145.69 -38.42 123 7 ARG A 43 ? ? -177.96 -73.94 124 7 SER A 46 ? ? -152.69 65.16 125 7 GLU A 52 ? ? -147.91 -130.10 126 7 ASN A 53 ? ? -123.12 -61.76 127 7 ALA A 63 ? ? 37.86 106.85 128 7 LEU A 64 ? ? -85.08 31.82 129 7 ARG A 76 ? ? -62.45 -76.13 130 7 LYS A 85 ? ? -63.12 99.95 131 7 GLU A 88 ? ? 55.08 -96.46 132 7 VAL A 90 ? ? -79.22 39.63 133 8 GLU A 2 ? ? 57.12 95.30 134 8 GLU A 6 ? ? -159.83 58.69 135 8 ALA A 7 ? ? 78.77 -81.73 136 8 THR A 16 ? ? -63.84 88.86 137 8 GLU A 18 ? ? -161.02 102.01 138 8 LEU A 19 ? ? -58.30 -179.50 139 8 ARG A 23 ? ? -42.54 -17.94 140 8 ALA A 35 ? ? 32.45 95.65 141 8 SER A 42 ? ? -146.17 -40.00 142 8 ARG A 43 ? ? -178.35 -68.78 143 8 SER A 46 ? ? -151.21 65.82 144 8 GLU A 52 ? ? -144.29 -124.64 145 8 ASN A 53 ? ? -122.88 -61.82 146 8 ALA A 63 ? ? 42.67 95.34 147 8 ARG A 76 ? ? -65.90 -75.82 148 8 LYS A 84 ? ? -133.00 -117.82 149 8 GLU A 88 ? ? 66.71 -9.01 150 8 LEU A 89 ? ? -127.54 -151.82 151 8 VAL A 90 ? ? 84.22 -29.10 152 9 ALA A 7 ? ? -43.58 -93.07 153 9 THR A 16 ? ? -60.37 88.38 154 9 SER A 20 ? ? -69.12 1.03 155 9 ALA A 35 ? ? 16.38 108.66 156 9 SER A 42 ? ? -154.10 -25.78 157 9 ARG A 43 ? ? 167.42 -52.62 158 9 SER A 46 ? ? 166.78 -22.57 159 9 GLU A 52 ? ? -81.93 -152.35 160 9 ASN A 53 ? ? -123.07 -65.36 161 9 ALA A 63 ? ? 36.85 113.57 162 9 LEU A 64 ? ? -85.36 42.06 163 9 ARG A 76 ? ? -57.22 -79.97 164 9 LYS A 85 ? ? -64.00 94.51 165 9 GLU A 88 ? ? 56.59 -77.97 166 10 GLU A 2 ? ? 68.60 -66.25 167 10 GLU A 6 ? ? 178.14 -44.51 168 10 ALA A 7 ? ? -22.99 -96.86 169 10 LYS A 9 ? ? -49.55 172.13 170 10 THR A 16 ? ? -63.25 92.11 171 10 GLU A 18 ? ? 72.89 108.95 172 10 PRO A 22 ? ? -69.24 32.41 173 10 ARG A 23 ? ? -43.25 -7.93 174 10 LEU A 33 ? ? -67.59 17.31 175 10 ASP A 39 ? ? -156.08 -5.77 176 10 SER A 40 ? ? -109.90 -164.51 177 10 SER A 42 ? ? -142.20 59.72 178 10 ARG A 43 ? ? 43.40 14.07 179 10 THR A 45 ? ? -155.73 81.62 180 10 SER A 46 ? ? -140.09 51.26 181 10 GLU A 52 ? ? -141.20 -148.01 182 10 ALA A 63 ? ? 38.38 88.83 183 10 ARG A 76 ? ? -62.64 -76.42 184 10 LYS A 84 ? ? -153.94 -122.79 185 10 GLU A 88 ? ? 63.17 -116.30 186 10 VAL A 90 ? ? 53.09 -110.23 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 21 ? ? 0.283 'SIDE CHAIN' 2 1 ARG A 23 ? ? 0.163 'SIDE CHAIN' 3 1 ARG A 31 ? ? 0.222 'SIDE CHAIN' 4 1 ARG A 32 ? ? 0.314 'SIDE CHAIN' 5 1 ARG A 43 ? ? 0.295 'SIDE CHAIN' 6 1 ARG A 62 ? ? 0.258 'SIDE CHAIN' 7 1 ARG A 76 ? ? 0.315 'SIDE CHAIN' 8 1 ARG A 81 ? ? 0.288 'SIDE CHAIN' 9 2 ARG A 21 ? ? 0.296 'SIDE CHAIN' 10 2 ARG A 23 ? ? 0.269 'SIDE CHAIN' 11 2 ARG A 31 ? ? 0.232 'SIDE CHAIN' 12 2 ARG A 32 ? ? 0.259 'SIDE CHAIN' 13 2 ARG A 43 ? ? 0.317 'SIDE CHAIN' 14 2 ARG A 62 ? ? 0.273 'SIDE CHAIN' 15 2 ARG A 76 ? ? 0.317 'SIDE CHAIN' 16 2 ARG A 81 ? ? 0.317 'SIDE CHAIN' 17 3 ARG A 21 ? ? 0.317 'SIDE CHAIN' 18 3 ARG A 31 ? ? 0.307 'SIDE CHAIN' 19 3 ARG A 32 ? ? 0.266 'SIDE CHAIN' 20 3 ARG A 43 ? ? 0.308 'SIDE CHAIN' 21 3 ARG A 62 ? ? 0.262 'SIDE CHAIN' 22 3 ARG A 76 ? ? 0.295 'SIDE CHAIN' 23 3 ARG A 81 ? ? 0.311 'SIDE CHAIN' 24 4 ARG A 21 ? ? 0.101 'SIDE CHAIN' 25 4 ARG A 23 ? ? 0.318 'SIDE CHAIN' 26 4 ARG A 31 ? ? 0.276 'SIDE CHAIN' 27 4 ARG A 32 ? ? 0.304 'SIDE CHAIN' 28 4 ARG A 43 ? ? 0.248 'SIDE CHAIN' 29 4 ARG A 62 ? ? 0.296 'SIDE CHAIN' 30 4 ARG A 76 ? ? 0.197 'SIDE CHAIN' 31 4 ARG A 81 ? ? 0.172 'SIDE CHAIN' 32 5 ARG A 21 ? ? 0.183 'SIDE CHAIN' 33 5 ARG A 23 ? ? 0.316 'SIDE CHAIN' 34 5 ARG A 31 ? ? 0.297 'SIDE CHAIN' 35 5 ARG A 32 ? ? 0.314 'SIDE CHAIN' 36 5 ARG A 43 ? ? 0.292 'SIDE CHAIN' 37 5 ARG A 62 ? ? 0.234 'SIDE CHAIN' 38 5 ARG A 76 ? ? 0.266 'SIDE CHAIN' 39 5 ARG A 81 ? ? 0.315 'SIDE CHAIN' 40 6 ARG A 21 ? ? 0.274 'SIDE CHAIN' 41 6 ARG A 23 ? ? 0.312 'SIDE CHAIN' 42 6 ARG A 31 ? ? 0.314 'SIDE CHAIN' 43 6 ARG A 32 ? ? 0.315 'SIDE CHAIN' 44 6 ARG A 43 ? ? 0.121 'SIDE CHAIN' 45 6 ARG A 62 ? ? 0.290 'SIDE CHAIN' 46 6 ARG A 76 ? ? 0.274 'SIDE CHAIN' 47 6 ARG A 81 ? ? 0.297 'SIDE CHAIN' 48 7 ARG A 21 ? ? 0.236 'SIDE CHAIN' 49 7 ARG A 23 ? ? 0.260 'SIDE CHAIN' 50 7 ARG A 31 ? ? 0.239 'SIDE CHAIN' 51 7 ARG A 32 ? ? 0.311 'SIDE CHAIN' 52 7 ARG A 43 ? ? 0.312 'SIDE CHAIN' 53 7 ARG A 62 ? ? 0.298 'SIDE CHAIN' 54 7 ARG A 76 ? ? 0.192 'SIDE CHAIN' 55 7 ARG A 81 ? ? 0.304 'SIDE CHAIN' 56 8 ARG A 21 ? ? 0.173 'SIDE CHAIN' 57 8 ARG A 23 ? ? 0.294 'SIDE CHAIN' 58 8 ARG A 31 ? ? 0.318 'SIDE CHAIN' 59 8 ARG A 32 ? ? 0.309 'SIDE CHAIN' 60 8 ARG A 43 ? ? 0.221 'SIDE CHAIN' 61 8 ARG A 62 ? ? 0.265 'SIDE CHAIN' 62 8 ARG A 76 ? ? 0.268 'SIDE CHAIN' 63 8 ARG A 81 ? ? 0.281 'SIDE CHAIN' 64 9 ARG A 21 ? ? 0.252 'SIDE CHAIN' 65 9 ARG A 23 ? ? 0.248 'SIDE CHAIN' 66 9 ARG A 31 ? ? 0.265 'SIDE CHAIN' 67 9 ARG A 32 ? ? 0.229 'SIDE CHAIN' 68 9 ARG A 43 ? ? 0.289 'SIDE CHAIN' 69 9 ARG A 62 ? ? 0.318 'SIDE CHAIN' 70 9 ARG A 76 ? ? 0.283 'SIDE CHAIN' 71 9 ARG A 81 ? ? 0.292 'SIDE CHAIN' 72 10 ARG A 21 ? ? 0.261 'SIDE CHAIN' 73 10 ARG A 23 ? ? 0.217 'SIDE CHAIN' 74 10 ARG A 31 ? ? 0.316 'SIDE CHAIN' 75 10 ARG A 32 ? ? 0.267 'SIDE CHAIN' 76 10 ARG A 43 ? ? 0.317 'SIDE CHAIN' 77 10 ARG A 62 ? ? 0.267 'SIDE CHAIN' 78 10 ARG A 76 ? ? 0.254 'SIDE CHAIN' 79 10 ARG A 81 ? ? 0.209 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1L7B _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'set of all structures within 5RT of LOWEST ENERGY STRUCTURE' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1L7B _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.3mM U-15N,13C; 300mM NH4OAc; 95% H20, 10% D20' _pdbx_nmr_sample_details.solvent_system '95% H20, 10% D20' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '300mM NH4OAc' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D PFG-[15N]HSQC' 1 2 1 '3D PFG- 3D PFG-(HA)CA(CO)NH' 1 3 1 '3D PFG-HA(CA)(CO)NH' 1 4 1 '3D PFG-HA(CA)NH' 1 5 1 '3D PFG-CBCANH' 1 6 1 '3D PFG-CBCA(CO)NH' 1 7 1 '3D PFG-(HA)CANH' 1 8 1 '3D PFG-H 3D PFG-HBHA(CB)(CA)(CO)NH' 1 9 1 '3D PFG-HCC(CO)NH-TOCSY' 1 10 1 '3D PFG-13C-EDITED NOESY' 1 11 1 '3D PFG-15N-EDITED NOESY' 1 12 1 '2D HSQC-J' 1 13 1 'N-H IPAP RESIDUAL DIPOLAR COUPLING MEASUREMENTS' 1 # _pdbx_nmr_details.entry_id 1L7B _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy.' # _pdbx_nmr_refine.entry_id 1L7B _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'X-PLOR-NIH VERSION 1.1.2 (G.M. CLORE,J. KUSZEWSKY,C. SCHWIETERS,N. TJANDRA) was also used for refinement' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1B VARIAN 1 processing VNMR 6.1B VARIAN 2 processing NMRPipe 97.231.15.18 Delaglio 3 'data analysis' AutoAssign 1.7.6 Moseley 4 'data analysis' AutoStructure '1.0 Beta' Huang 5 'structure solution' DYANA 1.5 Guntert 6 refinement DYANA 1.5 'Guntert, Wuthrich, et al.' 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 ILE N N N N 103 ILE CA C N S 104 ILE C C N N 105 ILE O O N N 106 ILE CB C N S 107 ILE CG1 C N N 108 ILE CG2 C N N 109 ILE CD1 C N N 110 ILE OXT O N N 111 ILE H H N N 112 ILE H2 H N N 113 ILE HA H N N 114 ILE HB H N N 115 ILE HG12 H N N 116 ILE HG13 H N N 117 ILE HG21 H N N 118 ILE HG22 H N N 119 ILE HG23 H N N 120 ILE HD11 H N N 121 ILE HD12 H N N 122 ILE HD13 H N N 123 ILE HXT H N N 124 LEU N N N N 125 LEU CA C N S 126 LEU C C N N 127 LEU O O N N 128 LEU CB C N N 129 LEU CG C N N 130 LEU CD1 C N N 131 LEU CD2 C N N 132 LEU OXT O N N 133 LEU H H N N 134 LEU H2 H N N 135 LEU HA H N N 136 LEU HB2 H N N 137 LEU HB3 H N N 138 LEU HG H N N 139 LEU HD11 H N N 140 LEU HD12 H N N 141 LEU HD13 H N N 142 LEU HD21 H N N 143 LEU HD22 H N N 144 LEU HD23 H N N 145 LEU HXT H N N 146 LYS N N N N 147 LYS CA C N S 148 LYS C C N N 149 LYS O O N N 150 LYS CB C N N 151 LYS CG C N N 152 LYS CD C N N 153 LYS CE C N N 154 LYS NZ N N N 155 LYS OXT O N N 156 LYS H H N N 157 LYS H2 H N N 158 LYS HA H N N 159 LYS HB2 H N N 160 LYS HB3 H N N 161 LYS HG2 H N N 162 LYS HG3 H N N 163 LYS HD2 H N N 164 LYS HD3 H N N 165 LYS HE2 H N N 166 LYS HE3 H N N 167 LYS HZ1 H N N 168 LYS HZ2 H N N 169 LYS HZ3 H N N 170 LYS HXT H N N 171 MET N N N N 172 MET CA C N S 173 MET C C N N 174 MET O O N N 175 MET CB C N N 176 MET CG C N N 177 MET SD S N N 178 MET CE C N N 179 MET OXT O N N 180 MET H H N N 181 MET H2 H N N 182 MET HA H N N 183 MET HB2 H N N 184 MET HB3 H N N 185 MET HG2 H N N 186 MET HG3 H N N 187 MET HE1 H N N 188 MET HE2 H N N 189 MET HE3 H N N 190 MET HXT H N N 191 PHE N N N N 192 PHE CA C N S 193 PHE C C N N 194 PHE O O N N 195 PHE CB C N N 196 PHE CG C Y N 197 PHE CD1 C Y N 198 PHE CD2 C Y N 199 PHE CE1 C Y N 200 PHE CE2 C Y N 201 PHE CZ C Y N 202 PHE OXT O N N 203 PHE H H N N 204 PHE H2 H N N 205 PHE HA H N N 206 PHE HB2 H N N 207 PHE HB3 H N N 208 PHE HD1 H N N 209 PHE HD2 H N N 210 PHE HE1 H N N 211 PHE HE2 H N N 212 PHE HZ H N N 213 PHE HXT H N N 214 PRO N N N N 215 PRO CA C N S 216 PRO C C N N 217 PRO O O N N 218 PRO CB C N N 219 PRO CG C N N 220 PRO CD C N N 221 PRO OXT O N N 222 PRO H H N N 223 PRO HA H N N 224 PRO HB2 H N N 225 PRO HB3 H N N 226 PRO HG2 H N N 227 PRO HG3 H N N 228 PRO HD2 H N N 229 PRO HD3 H N N 230 PRO HXT H N N 231 SER N N N N 232 SER CA C N S 233 SER C C N N 234 SER O O N N 235 SER CB C N N 236 SER OG O N N 237 SER OXT O N N 238 SER H H N N 239 SER H2 H N N 240 SER HA H N N 241 SER HB2 H N N 242 SER HB3 H N N 243 SER HG H N N 244 SER HXT H N N 245 THR N N N N 246 THR CA C N S 247 THR C C N N 248 THR O O N N 249 THR CB C N R 250 THR OG1 O N N 251 THR CG2 C N N 252 THR OXT O N N 253 THR H H N N 254 THR H2 H N N 255 THR HA H N N 256 THR HB H N N 257 THR HG1 H N N 258 THR HG21 H N N 259 THR HG22 H N N 260 THR HG23 H N N 261 THR HXT H N N 262 TYR N N N N 263 TYR CA C N S 264 TYR C C N N 265 TYR O O N N 266 TYR CB C N N 267 TYR CG C Y N 268 TYR CD1 C Y N 269 TYR CD2 C Y N 270 TYR CE1 C Y N 271 TYR CE2 C Y N 272 TYR CZ C Y N 273 TYR OH O N N 274 TYR OXT O N N 275 TYR H H N N 276 TYR H2 H N N 277 TYR HA H N N 278 TYR HB2 H N N 279 TYR HB3 H N N 280 TYR HD1 H N N 281 TYR HD2 H N N 282 TYR HE1 H N N 283 TYR HE2 H N N 284 TYR HH H N N 285 TYR HXT H N N 286 VAL N N N N 287 VAL CA C N S 288 VAL C C N N 289 VAL O O N N 290 VAL CB C N N 291 VAL CG1 C N N 292 VAL CG2 C N N 293 VAL OXT O N N 294 VAL H H N N 295 VAL H2 H N N 296 VAL HA H N N 297 VAL HB H N N 298 VAL HG11 H N N 299 VAL HG12 H N N 300 VAL HG13 H N N 301 VAL HG21 H N N 302 VAL HG22 H N N 303 VAL HG23 H N N 304 VAL HXT H N N 305 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 ILE N CA sing N N 97 ILE N H sing N N 98 ILE N H2 sing N N 99 ILE CA C sing N N 100 ILE CA CB sing N N 101 ILE CA HA sing N N 102 ILE C O doub N N 103 ILE C OXT sing N N 104 ILE CB CG1 sing N N 105 ILE CB CG2 sing N N 106 ILE CB HB sing N N 107 ILE CG1 CD1 sing N N 108 ILE CG1 HG12 sing N N 109 ILE CG1 HG13 sing N N 110 ILE CG2 HG21 sing N N 111 ILE CG2 HG22 sing N N 112 ILE CG2 HG23 sing N N 113 ILE CD1 HD11 sing N N 114 ILE CD1 HD12 sing N N 115 ILE CD1 HD13 sing N N 116 ILE OXT HXT sing N N 117 LEU N CA sing N N 118 LEU N H sing N N 119 LEU N H2 sing N N 120 LEU CA C sing N N 121 LEU CA CB sing N N 122 LEU CA HA sing N N 123 LEU C O doub N N 124 LEU C OXT sing N N 125 LEU CB CG sing N N 126 LEU CB HB2 sing N N 127 LEU CB HB3 sing N N 128 LEU CG CD1 sing N N 129 LEU CG CD2 sing N N 130 LEU CG HG sing N N 131 LEU CD1 HD11 sing N N 132 LEU CD1 HD12 sing N N 133 LEU CD1 HD13 sing N N 134 LEU CD2 HD21 sing N N 135 LEU CD2 HD22 sing N N 136 LEU CD2 HD23 sing N N 137 LEU OXT HXT sing N N 138 LYS N CA sing N N 139 LYS N H sing N N 140 LYS N H2 sing N N 141 LYS CA C sing N N 142 LYS CA CB sing N N 143 LYS CA HA sing N N 144 LYS C O doub N N 145 LYS C OXT sing N N 146 LYS CB CG sing N N 147 LYS CB HB2 sing N N 148 LYS CB HB3 sing N N 149 LYS CG CD sing N N 150 LYS CG HG2 sing N N 151 LYS CG HG3 sing N N 152 LYS CD CE sing N N 153 LYS CD HD2 sing N N 154 LYS CD HD3 sing N N 155 LYS CE NZ sing N N 156 LYS CE HE2 sing N N 157 LYS CE HE3 sing N N 158 LYS NZ HZ1 sing N N 159 LYS NZ HZ2 sing N N 160 LYS NZ HZ3 sing N N 161 LYS OXT HXT sing N N 162 MET N CA sing N N 163 MET N H sing N N 164 MET N H2 sing N N 165 MET CA C sing N N 166 MET CA CB sing N N 167 MET CA HA sing N N 168 MET C O doub N N 169 MET C OXT sing N N 170 MET CB CG sing N N 171 MET CB HB2 sing N N 172 MET CB HB3 sing N N 173 MET CG SD sing N N 174 MET CG HG2 sing N N 175 MET CG HG3 sing N N 176 MET SD CE sing N N 177 MET CE HE1 sing N N 178 MET CE HE2 sing N N 179 MET CE HE3 sing N N 180 MET OXT HXT sing N N 181 PHE N CA sing N N 182 PHE N H sing N N 183 PHE N H2 sing N N 184 PHE CA C sing N N 185 PHE CA CB sing N N 186 PHE CA HA sing N N 187 PHE C O doub N N 188 PHE C OXT sing N N 189 PHE CB CG sing N N 190 PHE CB HB2 sing N N 191 PHE CB HB3 sing N N 192 PHE CG CD1 doub Y N 193 PHE CG CD2 sing Y N 194 PHE CD1 CE1 sing Y N 195 PHE CD1 HD1 sing N N 196 PHE CD2 CE2 doub Y N 197 PHE CD2 HD2 sing N N 198 PHE CE1 CZ doub Y N 199 PHE CE1 HE1 sing N N 200 PHE CE2 CZ sing Y N 201 PHE CE2 HE2 sing N N 202 PHE CZ HZ sing N N 203 PHE OXT HXT sing N N 204 PRO N CA sing N N 205 PRO N CD sing N N 206 PRO N H sing N N 207 PRO CA C sing N N 208 PRO CA CB sing N N 209 PRO CA HA sing N N 210 PRO C O doub N N 211 PRO C OXT sing N N 212 PRO CB CG sing N N 213 PRO CB HB2 sing N N 214 PRO CB HB3 sing N N 215 PRO CG CD sing N N 216 PRO CG HG2 sing N N 217 PRO CG HG3 sing N N 218 PRO CD HD2 sing N N 219 PRO CD HD3 sing N N 220 PRO OXT HXT sing N N 221 SER N CA sing N N 222 SER N H sing N N 223 SER N H2 sing N N 224 SER CA C sing N N 225 SER CA CB sing N N 226 SER CA HA sing N N 227 SER C O doub N N 228 SER C OXT sing N N 229 SER CB OG sing N N 230 SER CB HB2 sing N N 231 SER CB HB3 sing N N 232 SER OG HG sing N N 233 SER OXT HXT sing N N 234 THR N CA sing N N 235 THR N H sing N N 236 THR N H2 sing N N 237 THR CA C sing N N 238 THR CA CB sing N N 239 THR CA HA sing N N 240 THR C O doub N N 241 THR C OXT sing N N 242 THR CB OG1 sing N N 243 THR CB CG2 sing N N 244 THR CB HB sing N N 245 THR OG1 HG1 sing N N 246 THR CG2 HG21 sing N N 247 THR CG2 HG22 sing N N 248 THR CG2 HG23 sing N N 249 THR OXT HXT sing N N 250 TYR N CA sing N N 251 TYR N H sing N N 252 TYR N H2 sing N N 253 TYR CA C sing N N 254 TYR CA CB sing N N 255 TYR CA HA sing N N 256 TYR C O doub N N 257 TYR C OXT sing N N 258 TYR CB CG sing N N 259 TYR CB HB2 sing N N 260 TYR CB HB3 sing N N 261 TYR CG CD1 doub Y N 262 TYR CG CD2 sing Y N 263 TYR CD1 CE1 sing Y N 264 TYR CD1 HD1 sing N N 265 TYR CD2 CE2 doub Y N 266 TYR CD2 HD2 sing N N 267 TYR CE1 CZ doub Y N 268 TYR CE1 HE1 sing N N 269 TYR CE2 CZ sing Y N 270 TYR CE2 HE2 sing N N 271 TYR CZ OH sing N N 272 TYR OH HH sing N N 273 TYR OXT HXT sing N N 274 VAL N CA sing N N 275 VAL N H sing N N 276 VAL N H2 sing N N 277 VAL CA C sing N N 278 VAL CA CB sing N N 279 VAL CA HA sing N N 280 VAL C O doub N N 281 VAL C OXT sing N N 282 VAL CB CG1 sing N N 283 VAL CB CG2 sing N N 284 VAL CB HB sing N N 285 VAL CG1 HG11 sing N N 286 VAL CG1 HG12 sing N N 287 VAL CG1 HG13 sing N N 288 VAL CG2 HG21 sing N N 289 VAL CG2 HG22 sing N N 290 VAL CG2 HG23 sing N N 291 VAL OXT HXT sing N N 292 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 500 ? 2 INOVA Varian 600 ? # _atom_sites.entry_id 1L7B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_