data_1LV3 # _entry.id 1LV3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LV3 pdb_00001lv3 10.2210/pdb1lv3/pdb RCSB RCSB016302 ? ? WWPDB D_1000016302 ? ? BMRB 5335 ? 10.13018/BMR5335 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-09-11 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 2 0 2020-02-05 5 'Structure model' 2 1 2023-06-14 6 'Structure model' 2 2 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Atomic model' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' Other 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' 10 5 'Structure model' Other 11 6 'Structure model' 'Data collection' 12 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' atom_site 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_nmr_representative 5 4 'Structure model' pdbx_nmr_software 6 4 'Structure model' pdbx_struct_assembly 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' pdbx_struct_oper_list 9 4 'Structure model' pdbx_validate_planes 10 4 'Structure model' pdbx_validate_torsion 11 4 'Structure model' struct_ref_seq_dif 12 5 'Structure model' database_2 13 5 'Structure model' pdbx_database_status 14 5 'Structure model' pdbx_struct_conn_angle 15 5 'Structure model' struct_conn 16 5 'Structure model' struct_site 17 6 'Structure model' chem_comp_atom 18 6 'Structure model' chem_comp_bond 19 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_atom_site.B_iso_or_equiv' 2 4 'Structure model' '_atom_site.Cartn_x' 3 4 'Structure model' '_atom_site.Cartn_y' 4 4 'Structure model' '_atom_site.Cartn_z' 5 4 'Structure model' '_pdbx_database_status.status_code_cs' 6 4 'Structure model' '_pdbx_nmr_representative.conformer_id' 7 4 'Structure model' '_pdbx_nmr_software.name' 8 4 'Structure model' '_pdbx_struct_conn_angle.value' 9 4 'Structure model' '_pdbx_validate_planes.rmsd' 10 4 'Structure model' '_pdbx_validate_torsion.PDB_model_num' 11 4 'Structure model' '_pdbx_validate_torsion.auth_comp_id' 12 4 'Structure model' '_pdbx_validate_torsion.auth_seq_id' 13 4 'Structure model' '_pdbx_validate_torsion.phi' 14 4 'Structure model' '_pdbx_validate_torsion.psi' 15 4 'Structure model' '_struct_ref_seq_dif.details' 16 5 'Structure model' '_database_2.pdbx_DOI' 17 5 'Structure model' '_database_2.pdbx_database_accession' 18 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 23 5 'Structure model' '_pdbx_struct_conn_angle.value' 24 5 'Structure model' '_struct_conn.pdbx_dist_value' 25 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 26 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 27 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 28 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 29 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 30 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 31 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 37 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 5 'Structure model' '_struct_site.pdbx_auth_seq_id' 40 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LV3 _pdbx_database_status.recvd_initial_deposition_date 2002-05-24 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_mr REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 5335 'chemical shifts of 1H, 15N and 13C resonances' unspecified TargetDB ET92 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Cort, J.R.' 2 'Yee, A.A.' 3 'Semesi, A.' 4 'Edwards, A.M.' 5 'Arrowsmith, C.H.' 6 'Kennedy, M.A.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'NMR structure of the Escherichia coli protein YacG: a novel sequence motif in the zinc-finger family of proteins.' _citation.journal_abbrev Proteins _citation.journal_volume 49 _citation.page_first 289 _citation.page_last 293 _citation.year 2002 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12211008 _citation.pdbx_database_id_DOI 10.1002/prot.10214 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ramelot, T.A.' 1 ? primary 'Cort, J.R.' 2 ? primary 'Yee, A.A.' 3 ? primary 'Semesi, A.' 4 ? primary 'Edwards, A.M.' 5 ? primary 'Arrowsmith, C.H.' 6 ? primary 'Kennedy, M.A.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HYPOTHETICAL PROTEIN YacG' 7595.426 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEEPKQ _entity_poly.pdbx_seq_one_letter_code_can GSHMSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEEPKQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ET92 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 GLU n 1 7 THR n 1 8 ILE n 1 9 THR n 1 10 VAL n 1 11 ASN n 1 12 CYS n 1 13 PRO n 1 14 THR n 1 15 CYS n 1 16 GLY n 1 17 LYS n 1 18 THR n 1 19 VAL n 1 20 VAL n 1 21 TRP n 1 22 GLY n 1 23 GLU n 1 24 ILE n 1 25 SER n 1 26 PRO n 1 27 PHE n 1 28 ARG n 1 29 PRO n 1 30 PHE n 1 31 CYS n 1 32 SER n 1 33 LYS n 1 34 ARG n 1 35 CYS n 1 36 GLN n 1 37 LEU n 1 38 ILE n 1 39 ASP n 1 40 LEU n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 ALA n 1 45 ALA n 1 46 GLU n 1 47 GLU n 1 48 LYS n 1 49 ARG n 1 50 ILE n 1 51 PRO n 1 52 SER n 1 53 SER n 1 54 GLY n 1 55 ASP n 1 56 LEU n 1 57 SER n 1 58 GLU n 1 59 SER n 1 60 ASP n 1 61 ASP n 1 62 TRP n 1 63 SER n 1 64 GLU n 1 65 GLU n 1 66 PRO n 1 67 LYS n 1 68 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene yacG _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 THR 7 4 4 THR THR A . n A 1 8 ILE 8 5 5 ILE ILE A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 ASN 11 8 8 ASN ASN A . n A 1 12 CYS 12 9 9 CYS CYS A . n A 1 13 PRO 13 10 10 PRO PRO A . n A 1 14 THR 14 11 11 THR THR A . n A 1 15 CYS 15 12 12 CYS CYS A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 LYS 17 14 14 LYS LYS A . n A 1 18 THR 18 15 15 THR THR A . n A 1 19 VAL 19 16 16 VAL VAL A . n A 1 20 VAL 20 17 17 VAL VAL A . n A 1 21 TRP 21 18 18 TRP TRP A . n A 1 22 GLY 22 19 19 GLY GLY A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 SER 25 22 22 SER SER A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 PHE 27 24 24 PHE PHE A . n A 1 28 ARG 28 25 25 ARG ARG A . n A 1 29 PRO 29 26 26 PRO PRO A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 CYS 31 28 28 CYS CYS A . n A 1 32 SER 32 29 29 SER SER A . n A 1 33 LYS 33 30 30 LYS LYS A . n A 1 34 ARG 34 31 31 ARG ARG A . n A 1 35 CYS 35 32 32 CYS CYS A . n A 1 36 GLN 36 33 33 GLN GLN A . n A 1 37 LEU 37 34 34 LEU LEU A . n A 1 38 ILE 38 35 35 ILE ILE A . n A 1 39 ASP 39 36 36 ASP ASP A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 TRP 43 40 40 TRP TRP A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 ALA 45 42 42 ALA ALA A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 GLU 47 44 44 GLU GLU A . n A 1 48 LYS 48 45 45 LYS LYS A . n A 1 49 ARG 49 46 46 ARG ARG A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 PRO 51 48 48 PRO PRO A . n A 1 52 SER 52 49 49 SER SER A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 GLY 54 51 51 GLY GLY A . n A 1 55 ASP 55 52 52 ASP ASP A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 SER 57 54 54 SER SER A . n A 1 58 GLU 58 55 55 GLU GLU A . n A 1 59 SER 59 56 56 SER SER A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 ASP 61 58 58 ASP ASP A . n A 1 62 TRP 62 59 59 TRP TRP A . n A 1 63 SER 63 60 60 SER SER A . n A 1 64 GLU 64 61 61 GLU GLU A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 PRO 66 63 63 PRO PRO A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 GLN 68 65 65 GLN GLN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 66 _pdbx_nonpoly_scheme.auth_seq_num 66 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1LV3 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1LV3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1LV3 _struct.title 'Solution NMR Structure of Zinc Finger Protein yacG from Escherichia coli. Northeast Structural Genomics Consortium Target ET92.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LV3 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;zinc finger, rubredoxin knuckle, C4 tetrahedral Zn+2, antiparallel beta strand and alpha helix, NESG Project, Structural Genomics, ET92, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YACG_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGDLSESDDWSEEPKQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P0A8H8 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LV3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A8H8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 65 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1LV3 GLY A 1 ? UNP P0A8H8 ? ? 'cloning artifact' -2 1 1 1LV3 SER A 2 ? UNP P0A8H8 ? ? 'cloning artifact' -1 2 1 1LV3 HIS A 3 ? UNP P0A8H8 ? ? 'cloning artifact' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 32 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 41 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 29 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 12 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 66 1_555 ? ? ? ? ? ? ? 2.287 ? ? metalc2 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 12 A ZN 66 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc3 metalc ? ? A CYS 31 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 66 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc4 metalc ? ? A CYS 35 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 32 A ZN 66 1_555 ? ? ? ? ? ? ? 2.293 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 12 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 15 ? A CYS 12 ? 1_555 115.9 ? 2 SG ? A CYS 12 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 31 ? A CYS 28 ? 1_555 116.5 ? 3 SG ? A CYS 15 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 31 ? A CYS 28 ? 1_555 102.5 ? 4 SG ? A CYS 12 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 110.1 ? 5 SG ? A CYS 15 ? A CYS 12 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 105.7 ? 6 SG ? A CYS 31 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 66 ? 1_555 SG ? A CYS 35 ? A CYS 32 ? 1_555 105.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 9 ? ASN A 11 ? THR A 6 ASN A 8 A 2 THR A 18 ? VAL A 20 ? THR A 15 VAL A 17 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 10 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 7 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 19 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 66 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 66' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 12 ? CYS A 9 . ? 1_555 ? 2 AC1 4 CYS A 15 ? CYS A 12 . ? 1_555 ? 3 AC1 4 CYS A 31 ? CYS A 28 . ? 1_555 ? 4 AC1 4 CYS A 35 ? CYS A 32 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 57.10 83.18 2 1 GLU A 3 ? ? 68.84 104.05 3 1 ILE A 21 ? ? -166.19 -45.70 4 1 PHE A 24 ? ? -111.15 68.58 5 1 PHE A 27 ? ? 66.02 161.40 6 1 ARG A 46 ? ? 66.09 158.67 7 1 ASP A 52 ? ? 47.10 -131.18 8 1 SER A 56 ? ? 62.85 80.34 9 1 SER A 60 ? ? 50.88 81.42 10 1 GLU A 62 ? ? 68.44 160.45 11 2 SER A 2 ? ? -89.85 39.28 12 2 GLU A 20 ? ? -158.89 57.42 13 2 ILE A 21 ? ? -120.35 -52.31 14 2 PHE A 24 ? ? -113.96 66.68 15 2 PHE A 27 ? ? 68.00 159.45 16 2 ALA A 42 ? ? -162.71 59.36 17 2 GLU A 43 ? ? 54.91 77.85 18 2 GLU A 44 ? ? -167.73 -38.91 19 2 SER A 54 ? ? 53.74 81.28 20 2 SER A 56 ? ? 67.29 67.73 21 2 ASP A 58 ? ? 66.57 94.98 22 3 THR A 4 ? ? 68.13 130.67 23 3 ILE A 21 ? ? -174.99 -40.13 24 3 PHE A 24 ? ? -110.26 68.52 25 3 PHE A 27 ? ? 65.54 173.48 26 3 TRP A 40 ? ? -140.02 -54.40 27 3 LYS A 45 ? ? -118.19 78.05 28 3 TRP A 59 ? ? -96.85 56.34 29 3 GLU A 61 ? ? -10.17 -84.96 30 3 LYS A 64 ? ? 168.61 128.95 31 4 GLU A 3 ? ? 64.18 94.11 32 4 ILE A 21 ? ? -153.80 -42.17 33 4 PHE A 24 ? ? -119.41 76.16 34 4 LYS A 45 ? ? -174.37 142.56 35 4 ARG A 46 ? ? 64.62 122.12 36 4 SER A 56 ? ? 67.30 171.31 37 4 GLU A 61 ? ? 55.69 91.13 38 4 GLU A 62 ? ? 66.54 79.69 39 5 SER A 2 ? ? 52.85 84.76 40 5 GLU A 3 ? ? -37.19 106.46 41 5 THR A 4 ? ? -65.00 95.27 42 5 GLU A 20 ? ? -162.68 35.33 43 5 PRO A 23 ? ? -79.80 46.14 44 5 ARG A 25 ? ? 63.26 174.37 45 5 PHE A 27 ? ? -92.39 -69.61 46 5 CYS A 28 ? ? 167.59 -40.45 47 5 TRP A 40 ? ? -138.12 -58.40 48 5 SER A 50 ? ? -96.57 -69.47 49 5 SER A 54 ? ? 55.83 74.31 50 5 GLU A 62 ? ? 62.17 91.93 51 6 SER A 2 ? ? -104.85 74.48 52 6 GLU A 20 ? ? -158.96 52.47 53 6 PHE A 24 ? ? -104.92 64.61 54 6 PHE A 27 ? ? 65.96 173.95 55 6 ALA A 41 ? ? -103.61 72.88 56 6 ALA A 42 ? ? -142.55 50.20 57 6 GLU A 43 ? ? 56.43 76.37 58 6 GLU A 44 ? ? -150.33 26.61 59 6 SER A 54 ? ? 60.80 -170.06 60 6 SER A 56 ? ? 67.01 117.25 61 6 ASP A 58 ? ? 74.91 -14.65 62 7 GLU A 20 ? ? -155.82 51.46 63 7 PHE A 24 ? ? -116.72 69.60 64 7 PHE A 27 ? ? 66.83 167.92 65 7 TRP A 40 ? ? -137.23 -63.41 66 7 ALA A 42 ? ? 59.22 85.74 67 7 SER A 49 ? ? 50.70 -144.88 68 7 SER A 54 ? ? 67.82 -71.83 69 7 GLU A 55 ? ? -125.48 -53.77 70 7 GLU A 62 ? ? 68.05 116.47 71 8 ILE A 21 ? ? -169.52 -42.44 72 8 PHE A 24 ? ? -110.99 65.61 73 8 PHE A 27 ? ? 66.56 166.75 74 8 ALA A 42 ? ? 65.10 71.06 75 8 SER A 50 ? ? -91.40 -85.70 76 8 ASP A 57 ? ? -155.96 -66.72 77 9 GLU A 20 ? ? -159.05 83.23 78 9 ILE A 21 ? ? -156.18 -43.43 79 9 PHE A 24 ? ? -110.27 65.04 80 9 PHE A 27 ? ? 65.53 175.31 81 9 GLU A 43 ? ? 53.46 96.22 82 9 ILE A 47 ? ? 67.59 104.29 83 9 SER A 49 ? ? -150.64 -49.24 84 9 SER A 50 ? ? -144.28 -59.54 85 9 ASP A 58 ? ? 58.54 -173.08 86 10 GLU A 20 ? ? -159.50 52.74 87 10 PHE A 24 ? ? -107.31 66.58 88 10 PHE A 27 ? ? 65.71 172.64 89 10 TRP A 59 ? ? 60.84 81.72 90 10 GLU A 62 ? ? 52.07 76.43 91 11 THR A 4 ? ? 64.83 108.83 92 11 GLU A 20 ? ? -150.75 52.56 93 11 PHE A 24 ? ? -117.00 72.20 94 11 PHE A 27 ? ? 65.56 172.45 95 11 TRP A 40 ? ? -137.49 -47.72 96 11 LEU A 53 ? ? 74.30 150.89 97 11 SER A 56 ? ? -105.48 78.56 98 11 SER A 60 ? ? -132.08 -52.45 99 11 GLU A 61 ? ? -150.15 -58.57 100 12 SER A 2 ? ? 73.41 -70.52 101 12 THR A 4 ? ? 71.91 132.14 102 12 GLU A 20 ? ? -160.68 92.84 103 12 ILE A 21 ? ? -165.64 -46.35 104 12 PHE A 24 ? ? -112.87 64.46 105 12 PHE A 27 ? ? 65.61 165.98 106 12 TRP A 40 ? ? -143.71 -59.51 107 12 LEU A 53 ? ? -113.76 79.56 108 12 SER A 60 ? ? -136.72 -50.71 109 13 ILE A 21 ? ? -165.48 -40.92 110 13 PHE A 24 ? ? -109.77 68.59 111 13 PHE A 27 ? ? 65.55 172.31 112 13 GLU A 55 ? ? -93.03 -60.72 113 13 GLU A 62 ? ? 55.53 79.05 114 14 ILE A 21 ? ? -169.35 -45.21 115 14 PHE A 24 ? ? -116.92 71.71 116 14 PHE A 27 ? ? 65.72 175.43 117 14 ARG A 46 ? ? -107.94 61.08 118 14 SER A 49 ? ? -172.68 -52.07 119 15 GLU A 3 ? ? 66.84 100.73 120 15 GLU A 20 ? ? -142.10 32.25 121 15 PHE A 24 ? ? -112.57 68.21 122 15 PHE A 27 ? ? 67.99 163.93 123 15 ALA A 41 ? ? -129.56 -52.59 124 15 SER A 49 ? ? -134.16 -53.63 125 15 ASP A 52 ? ? -91.90 -142.18 126 15 GLU A 55 ? ? -105.45 79.61 127 15 ASP A 57 ? ? -130.05 -49.16 128 15 GLU A 62 ? ? 66.66 146.57 129 15 LYS A 64 ? ? 83.14 116.33 130 16 GLU A 20 ? ? -160.35 91.65 131 16 ILE A 21 ? ? -167.63 -42.45 132 16 PHE A 24 ? ? -108.98 65.36 133 16 PHE A 27 ? ? 65.87 173.12 134 16 TRP A 40 ? ? -139.79 -56.63 135 16 ALA A 42 ? ? -117.04 62.98 136 16 SER A 50 ? ? 60.56 93.76 137 16 SER A 54 ? ? 56.02 -173.12 138 16 GLU A 62 ? ? 68.32 85.14 139 16 LYS A 64 ? ? -137.96 -51.80 140 17 GLU A 20 ? ? -160.42 83.92 141 17 ILE A 21 ? ? -157.25 -41.65 142 17 PHE A 24 ? ? -108.91 64.82 143 17 PHE A 27 ? ? 66.40 -171.19 144 17 SER A 56 ? ? 60.05 92.23 145 17 GLU A 61 ? ? -162.20 104.80 146 18 ILE A 21 ? ? -160.35 94.90 147 18 PHE A 24 ? ? -141.64 49.78 148 18 ARG A 25 ? ? 63.27 -176.83 149 18 TRP A 40 ? ? -138.68 -59.28 150 18 ALA A 42 ? ? 60.83 77.81 151 18 ASP A 52 ? ? 56.49 70.16 152 18 ASP A 57 ? ? -120.48 -54.80 153 18 ASP A 58 ? ? 56.51 70.72 154 18 TRP A 59 ? ? 71.54 132.30 155 19 ILE A 21 ? ? -177.53 103.12 156 19 ARG A 25 ? ? 65.77 178.28 157 19 PHE A 27 ? ? -131.03 -69.83 158 19 CYS A 28 ? ? 168.74 -38.73 159 19 GLU A 43 ? ? -109.42 -66.13 160 19 LYS A 45 ? ? -130.27 -57.69 161 19 SER A 49 ? ? 63.31 175.48 162 19 SER A 50 ? ? 69.54 108.38 163 19 SER A 54 ? ? -103.83 -75.93 164 19 SER A 56 ? ? -149.10 36.47 165 19 LYS A 64 ? ? -147.19 -58.44 166 20 GLU A 20 ? ? -156.70 53.66 167 20 PHE A 27 ? ? 66.01 167.10 168 20 TRP A 40 ? ? -139.77 -60.24 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 25 ? ? 0.309 'SIDE CHAIN' 2 1 ARG A 31 ? ? 0.290 'SIDE CHAIN' 3 1 ARG A 46 ? ? 0.284 'SIDE CHAIN' 4 2 ARG A 25 ? ? 0.288 'SIDE CHAIN' 5 2 ARG A 31 ? ? 0.298 'SIDE CHAIN' 6 2 ARG A 46 ? ? 0.318 'SIDE CHAIN' 7 3 ARG A 25 ? ? 0.310 'SIDE CHAIN' 8 3 ARG A 31 ? ? 0.304 'SIDE CHAIN' 9 3 ARG A 46 ? ? 0.297 'SIDE CHAIN' 10 4 ARG A 25 ? ? 0.235 'SIDE CHAIN' 11 4 ARG A 31 ? ? 0.317 'SIDE CHAIN' 12 4 ARG A 46 ? ? 0.316 'SIDE CHAIN' 13 5 ARG A 25 ? ? 0.279 'SIDE CHAIN' 14 5 ARG A 31 ? ? 0.313 'SIDE CHAIN' 15 5 ARG A 46 ? ? 0.311 'SIDE CHAIN' 16 6 ARG A 25 ? ? 0.310 'SIDE CHAIN' 17 6 ARG A 31 ? ? 0.313 'SIDE CHAIN' 18 6 ARG A 46 ? ? 0.294 'SIDE CHAIN' 19 7 ARG A 25 ? ? 0.315 'SIDE CHAIN' 20 7 ARG A 31 ? ? 0.318 'SIDE CHAIN' 21 7 ARG A 46 ? ? 0.315 'SIDE CHAIN' 22 8 ARG A 25 ? ? 0.314 'SIDE CHAIN' 23 8 ARG A 31 ? ? 0.313 'SIDE CHAIN' 24 8 ARG A 46 ? ? 0.269 'SIDE CHAIN' 25 9 ARG A 25 ? ? 0.303 'SIDE CHAIN' 26 9 ARG A 31 ? ? 0.306 'SIDE CHAIN' 27 9 ARG A 46 ? ? 0.308 'SIDE CHAIN' 28 10 ARG A 25 ? ? 0.316 'SIDE CHAIN' 29 10 ARG A 31 ? ? 0.316 'SIDE CHAIN' 30 10 ARG A 46 ? ? 0.311 'SIDE CHAIN' 31 11 ARG A 25 ? ? 0.309 'SIDE CHAIN' 32 11 ARG A 31 ? ? 0.314 'SIDE CHAIN' 33 11 ARG A 46 ? ? 0.317 'SIDE CHAIN' 34 12 ARG A 25 ? ? 0.313 'SIDE CHAIN' 35 12 ARG A 31 ? ? 0.315 'SIDE CHAIN' 36 12 ARG A 46 ? ? 0.281 'SIDE CHAIN' 37 13 ARG A 25 ? ? 0.297 'SIDE CHAIN' 38 13 ARG A 31 ? ? 0.315 'SIDE CHAIN' 39 13 ARG A 46 ? ? 0.311 'SIDE CHAIN' 40 14 ARG A 25 ? ? 0.316 'SIDE CHAIN' 41 14 ARG A 31 ? ? 0.315 'SIDE CHAIN' 42 14 ARG A 46 ? ? 0.305 'SIDE CHAIN' 43 15 ARG A 25 ? ? 0.299 'SIDE CHAIN' 44 15 ARG A 31 ? ? 0.306 'SIDE CHAIN' 45 15 ARG A 46 ? ? 0.313 'SIDE CHAIN' 46 16 ARG A 25 ? ? 0.306 'SIDE CHAIN' 47 16 ARG A 31 ? ? 0.318 'SIDE CHAIN' 48 16 ARG A 46 ? ? 0.314 'SIDE CHAIN' 49 17 ARG A 25 ? ? 0.296 'SIDE CHAIN' 50 17 ARG A 31 ? ? 0.310 'SIDE CHAIN' 51 17 ARG A 46 ? ? 0.292 'SIDE CHAIN' 52 18 ARG A 25 ? ? 0.316 'SIDE CHAIN' 53 18 ARG A 31 ? ? 0.318 'SIDE CHAIN' 54 18 ARG A 46 ? ? 0.305 'SIDE CHAIN' 55 19 ARG A 25 ? ? 0.309 'SIDE CHAIN' 56 19 ARG A 31 ? ? 0.246 'SIDE CHAIN' 57 19 ARG A 46 ? ? 0.310 'SIDE CHAIN' 58 20 ARG A 25 ? ? 0.310 'SIDE CHAIN' 59 20 ARG A 31 ? ? 0.119 'SIDE CHAIN' 60 20 ARG A 46 ? ? 0.317 'SIDE CHAIN' # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 1LV3 _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with favorable non-bond energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1LV3 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '2mM YacG U-15N, 450 mM NaCl, 25 mM Na2HPO4, 10 mM DTT' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '450 mM salt, 25 mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 4D_13C-separated_NOESY 2 1 1 3D_13C-separated_NOESY 3 1 1 3D_15N-separated_NOESY 4 1 1 HNHA 5 1 1 2H_exchange # _pdbx_nmr_refine.entry_id 1LV3 _pdbx_nmr_refine.method 'distance geometry and simulated annealing' _pdbx_nmr_refine.details ;THE STRUCTURES ARE BASED ON A TOTAL OF 396 RESTRAINTS. SUMMARY OF EXPERIMENTAL CONSTRAINTS: DISTANCE CONSTRAINTS: TOTAL = 367; ZN RESTRAINTS 10; INTRA-RESIDUE [I=J] = 93; SEQUENTIAL [(I-J)=1] = 120; MEDIUM RANGE [1<(I-J)<5] = 52; LONG RANGE [(I-J)>=5] = 86; NUMBER OF DISTANCE CONSTRAINTS PER RESIDUE (RESIDUES 4-40)= 9.8; DIHEDRAL-ANGLE CONSTRAINTS = 29 (16 PHI, 13 PSI); TOTAL HYDROGEN BOND CONSTRAINTS = 6 (2 PER H-BOND); TOTAL NUMBER OF CONSTRAINTS PER RESIDUE (4-40)= 10.6; NUMBER OF LONG RANGE CONSTRAINTS PER RESIDUE = 2.6; NUMBER OF STRUCTURES COMPUTED = 40; NUMBER OF STRUCTURES USED = 20. AVERAGE RESIDUAL CONSTRAINT VIOLATIONS: DISTANCE VIOLATIONS >0.0 ANG = 20. AVERAGE R.M.S. DISTANCE VIOLATION = 0.011 ANG. MAXIMUM NUMBER OF DISTANCE VIOLATIONS 26. AVERAGE DIHEDRAL ANGLE VIOLATIONS: >0 DEG = 0.8; MAX NUMBER OF ANGLE VIOLATION = 2 DEG; AVERAGE R.M.S. ANGLE VIOLATION = 0.11 DEG. RMSD VALUES: BACKBONE ATOMS (N,C,C') OF RESIDUES (4-40) = 0.46 ANG; BACKBONE ATOMS(N,C,C') OF SECONDARY STRUCTURE RESIDUES (6-17, 30-37) = 0.22 ANG; ALL HEAVY ATOMS OF RESIDUES (4-40) = 1.01 ANG; ALL HEAVY ATOMS OF SECONDARY STRUCTURE RESIDUES = 0.77 ANG. PROCHECK USING RESIDUES (4-40): MOST FAVORED REGIONS = 76%; ADDITIONAL ALLOWED REGIONS = 16%; GENEROUSLY ALLOWED REGIONS = 4%; DISALLOWED REGIONS = 4%. PROCHECK USING SECONDARY STRUCTURE RESIDUES (6-17, 30-37): MOST FAVOREDREGIONS = 95%; ADDITIONAL ALLOWED REGIONS = 5%; GENEROUSLY ALLOWED REGIONS =0%; DISALLOWED REGIONS = 0%. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.84 'structure solution' ? 1 Felix 98 processing ? 2 VNMR ? collection ? 3 Sparky ? 'data analysis' ? 4 X-PLOR 3.84 refinement 'Brunger, A.T.' 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A HIS 0 ? A HIS 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 ZN ZN ZN N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 VAL N CA sing N N 332 VAL N H sing N N 333 VAL N H2 sing N N 334 VAL CA C sing N N 335 VAL CA CB sing N N 336 VAL CA HA sing N N 337 VAL C O doub N N 338 VAL C OXT sing N N 339 VAL CB CG1 sing N N 340 VAL CB CG2 sing N N 341 VAL CB HB sing N N 342 VAL CG1 HG11 sing N N 343 VAL CG1 HG12 sing N N 344 VAL CG1 HG13 sing N N 345 VAL CG2 HG21 sing N N 346 VAL CG2 HG22 sing N N 347 VAL CG2 HG23 sing N N 348 VAL OXT HXT sing N N 349 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 600 2 ? Varian INOVA 750 3 ? Varian INOVA 800 # _atom_sites.entry_id 1LV3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_