data_1LW7 # _entry.id 1LW7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1LW7 RCSB RCSB016337 WWPDB D_1000016337 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LW7 _pdbx_database_status.recvd_initial_deposition_date 2002-05-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Singh, S.K.' 1 'Kurnasov, O.V.' 2 'Chen, B.' 3 'Robinson, H.' 4 'Grishin, N.V.' 5 'Osterman, A.L.' 6 'Zhang, H.' 7 # _citation.id primary _citation.title ;Crystal structure of Haemophilus influenzae NadR protein. A bifunctional enzyme endowed with NMN adenyltransferase and ribosylnicotinimide kinase activities. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 277 _citation.page_first 33291 _citation.page_last 33299 _citation.year 2002 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12068016 _citation.pdbx_database_id_DOI 10.1074/jbc.M204368200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Singh, S.K.' 1 primary 'Kurnasov, O.V.' 2 primary 'Chen, B.' 3 primary 'Robinson, H.' 4 primary 'Grishin, N.V.' 5 primary 'Osterman, A.L.' 6 primary 'Zhang, H.' 7 # _cell.entry_id 1LW7 _cell.length_a 106.871 _cell.length_b 106.871 _cell.length_c 174.945 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LW7 _symmetry.space_group_name_H-M 'P 64 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 181 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRANSCRIPTIONAL REGULATOR NADR' 42953.898 1 ? ? NadR ? 2 non-polymer syn 'SULFATE ION' 96.063 5 ? ? ? ? 3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;EKKVGVIFGKFYPVHTGHIN(MSE)IYEAFSKVDELHVIVCSDTVRDLKLFYDSK(MSE)KR(MSE)PTVQDRLRW (MSE)QQIFKYQKNQIFIHHLVEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSSEPQDKAPYEKYLGLEVSLVDPDR TFFNVSATKIRTTPFQYWKFIPKEARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQY SDYPQ(MSE)ALGHQRYIDYAVRHSHKIAFIDTDFITTQAFCIQYEGKAHPFLDS(MSE)IKEYPFDVTILLKNNTEWVD DGLRSLGSQKQRQQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQNTTFPIKGTSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;EKKVGVIFGKFYPVHTGHINMIYEAFSKVDELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLRWMQQIFKYQKNQIFIHH LVEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSSEPQDKAPYEKYLGLEVSLVDPDRTFFNVSATKIRTTPFQYWKF IPKEARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQMALGHQRYIDYAVRH SHKIAFIDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLRSLGSQKQRQQFQQLLKKLLDKYKV PYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQNTTFPIKGTSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 LYS n 1 3 LYS n 1 4 VAL n 1 5 GLY n 1 6 VAL n 1 7 ILE n 1 8 PHE n 1 9 GLY n 1 10 LYS n 1 11 PHE n 1 12 TYR n 1 13 PRO n 1 14 VAL n 1 15 HIS n 1 16 THR n 1 17 GLY n 1 18 HIS n 1 19 ILE n 1 20 ASN n 1 21 MSE n 1 22 ILE n 1 23 TYR n 1 24 GLU n 1 25 ALA n 1 26 PHE n 1 27 SER n 1 28 LYS n 1 29 VAL n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 HIS n 1 34 VAL n 1 35 ILE n 1 36 VAL n 1 37 CYS n 1 38 SER n 1 39 ASP n 1 40 THR n 1 41 VAL n 1 42 ARG n 1 43 ASP n 1 44 LEU n 1 45 LYS n 1 46 LEU n 1 47 PHE n 1 48 TYR n 1 49 ASP n 1 50 SER n 1 51 LYS n 1 52 MSE n 1 53 LYS n 1 54 ARG n 1 55 MSE n 1 56 PRO n 1 57 THR n 1 58 VAL n 1 59 GLN n 1 60 ASP n 1 61 ARG n 1 62 LEU n 1 63 ARG n 1 64 TRP n 1 65 MSE n 1 66 GLN n 1 67 GLN n 1 68 ILE n 1 69 PHE n 1 70 LYS n 1 71 TYR n 1 72 GLN n 1 73 LYS n 1 74 ASN n 1 75 GLN n 1 76 ILE n 1 77 PHE n 1 78 ILE n 1 79 HIS n 1 80 HIS n 1 81 LEU n 1 82 VAL n 1 83 GLU n 1 84 ASP n 1 85 GLY n 1 86 ILE n 1 87 PRO n 1 88 SER n 1 89 TYR n 1 90 PRO n 1 91 ASN n 1 92 GLY n 1 93 TRP n 1 94 GLN n 1 95 SER n 1 96 TRP n 1 97 SER n 1 98 GLU n 1 99 ALA n 1 100 VAL n 1 101 LYS n 1 102 THR n 1 103 LEU n 1 104 PHE n 1 105 HIS n 1 106 GLU n 1 107 LYS n 1 108 HIS n 1 109 PHE n 1 110 GLU n 1 111 PRO n 1 112 SER n 1 113 ILE n 1 114 VAL n 1 115 PHE n 1 116 SER n 1 117 SER n 1 118 GLU n 1 119 PRO n 1 120 GLN n 1 121 ASP n 1 122 LYS n 1 123 ALA n 1 124 PRO n 1 125 TYR n 1 126 GLU n 1 127 LYS n 1 128 TYR n 1 129 LEU n 1 130 GLY n 1 131 LEU n 1 132 GLU n 1 133 VAL n 1 134 SER n 1 135 LEU n 1 136 VAL n 1 137 ASP n 1 138 PRO n 1 139 ASP n 1 140 ARG n 1 141 THR n 1 142 PHE n 1 143 PHE n 1 144 ASN n 1 145 VAL n 1 146 SER n 1 147 ALA n 1 148 THR n 1 149 LYS n 1 150 ILE n 1 151 ARG n 1 152 THR n 1 153 THR n 1 154 PRO n 1 155 PHE n 1 156 GLN n 1 157 TYR n 1 158 TRP n 1 159 LYS n 1 160 PHE n 1 161 ILE n 1 162 PRO n 1 163 LYS n 1 164 GLU n 1 165 ALA n 1 166 ARG n 1 167 PRO n 1 168 PHE n 1 169 PHE n 1 170 ALA n 1 171 LYS n 1 172 THR n 1 173 VAL n 1 174 ALA n 1 175 ILE n 1 176 LEU n 1 177 GLY n 1 178 GLY n 1 179 GLU n 1 180 SER n 1 181 SER n 1 182 GLY n 1 183 LYS n 1 184 SER n 1 185 VAL n 1 186 LEU n 1 187 VAL n 1 188 ASN n 1 189 LYS n 1 190 LEU n 1 191 ALA n 1 192 ALA n 1 193 VAL n 1 194 PHE n 1 195 ASN n 1 196 THR n 1 197 THR n 1 198 SER n 1 199 ALA n 1 200 TRP n 1 201 GLU n 1 202 TYR n 1 203 GLY n 1 204 ARG n 1 205 GLU n 1 206 PHE n 1 207 VAL n 1 208 PHE n 1 209 GLU n 1 210 LYS n 1 211 LEU n 1 212 GLY n 1 213 GLY n 1 214 ASP n 1 215 GLU n 1 216 GLN n 1 217 ALA n 1 218 MET n 1 219 GLN n 1 220 TYR n 1 221 SER n 1 222 ASP n 1 223 TYR n 1 224 PRO n 1 225 GLN n 1 226 MSE n 1 227 ALA n 1 228 LEU n 1 229 GLY n 1 230 HIS n 1 231 GLN n 1 232 ARG n 1 233 TYR n 1 234 ILE n 1 235 ASP n 1 236 TYR n 1 237 ALA n 1 238 VAL n 1 239 ARG n 1 240 HIS n 1 241 SER n 1 242 HIS n 1 243 LYS n 1 244 ILE n 1 245 ALA n 1 246 PHE n 1 247 ILE n 1 248 ASP n 1 249 THR n 1 250 ASP n 1 251 PHE n 1 252 ILE n 1 253 THR n 1 254 THR n 1 255 GLN n 1 256 ALA n 1 257 PHE n 1 258 CYS n 1 259 ILE n 1 260 GLN n 1 261 TYR n 1 262 GLU n 1 263 GLY n 1 264 LYS n 1 265 ALA n 1 266 HIS n 1 267 PRO n 1 268 PHE n 1 269 LEU n 1 270 ASP n 1 271 SER n 1 272 MSE n 1 273 ILE n 1 274 LYS n 1 275 GLU n 1 276 TYR n 1 277 PRO n 1 278 PHE n 1 279 ASP n 1 280 VAL n 1 281 THR n 1 282 ILE n 1 283 LEU n 1 284 LEU n 1 285 LYS n 1 286 ASN n 1 287 ASN n 1 288 THR n 1 289 GLU n 1 290 TRP n 1 291 VAL n 1 292 ASP n 1 293 ASP n 1 294 GLY n 1 295 LEU n 1 296 ARG n 1 297 SER n 1 298 LEU n 1 299 GLY n 1 300 SER n 1 301 GLN n 1 302 LYS n 1 303 GLN n 1 304 ARG n 1 305 GLN n 1 306 GLN n 1 307 PHE n 1 308 GLN n 1 309 GLN n 1 310 LEU n 1 311 LEU n 1 312 LYS n 1 313 LYS n 1 314 LEU n 1 315 LEU n 1 316 ASP n 1 317 LYS n 1 318 TYR n 1 319 LYS n 1 320 VAL n 1 321 PRO n 1 322 TYR n 1 323 ILE n 1 324 GLU n 1 325 ILE n 1 326 GLU n 1 327 SER n 1 328 PRO n 1 329 SER n 1 330 TYR n 1 331 LEU n 1 332 ASP n 1 333 ARG n 1 334 TYR n 1 335 ASN n 1 336 GLN n 1 337 VAL n 1 338 LYS n 1 339 ALA n 1 340 VAL n 1 341 ILE n 1 342 GLU n 1 343 LYS n 1 344 VAL n 1 345 LEU n 1 346 ASN n 1 347 GLU n 1 348 GLU n 1 349 GLU n 1 350 ILE n 1 351 SER n 1 352 GLU n 1 353 LEU n 1 354 GLN n 1 355 ASN n 1 356 THR n 1 357 THR n 1 358 PHE n 1 359 PRO n 1 360 ILE n 1 361 LYS n 1 362 GLY n 1 363 THR n 1 364 SER n 1 365 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Haemophilus _entity_src_gen.pdbx_gene_src_gene NadR _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus influenzae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 727 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NADR_HAEIN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EKKVGVIFGKFYPVHTGHINMIYEAFSKVDELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRLRWMQQIFKYQKNQIFIHH LVEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSSEPQDKAPYEKYLGLEVSLVDPDRTFFNVSATKIRTTPFQYWKF IPKEARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQMALGHQRYIDYAVRH SHKIAFIDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLRSLGSQKQRQQFQQLLKKLLDKYKV PYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQNTTFPIKGTSQ ; _struct_ref.pdbx_align_begin 57 _struct_ref.pdbx_db_accession P44308 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1LW7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 365 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P44308 _struct_ref_seq.db_align_beg 57 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 421 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 57 _struct_ref_seq.pdbx_auth_seq_align_end 421 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1LW7 MSE A 21 ? UNP P44308 MET 77 'MODIFIED RESIDUE' 77 1 1 1LW7 MSE A 52 ? UNP P44308 MET 108 'MODIFIED RESIDUE' 108 2 1 1LW7 MSE A 55 ? UNP P44308 MET 111 'MODIFIED RESIDUE' 111 3 1 1LW7 MSE A 65 ? UNP P44308 MET 121 'MODIFIED RESIDUE' 121 4 1 1LW7 MSE A 226 ? UNP P44308 MET 282 'MODIFIED RESIDUE' 282 5 1 1LW7 MSE A 272 ? UNP P44308 MET 328 'MODIFIED RESIDUE' 328 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1LW7 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 63 _exptl_crystal.density_Matthews 3.3 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pdbx_details '0.8M Ammonium sulfate, 0.1M MES pH 5.6, Protein Conc. 10 mg/ml, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2001-10-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9840 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X12B' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X12B _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9840 # _reflns.entry_id 1LW7 _reflns.observed_criterion_sigma_F 0.00 _reflns.observed_criterion_sigma_I -3.00 _reflns.d_resolution_high 2.90 _reflns.d_resolution_low 30.00 _reflns.number_all 13327 _reflns.number_obs 13327 _reflns.percent_possible_obs 98 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.041 _reflns.pdbx_netI_over_sigmaI 17.6 _reflns.B_iso_Wilson_estimate 137.00 _reflns.pdbx_redundancy 13.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.90 _reflns_shell.d_res_low 3.08 _reflns_shell.percent_possible_all 97.3 _reflns_shell.Rmerge_I_obs 0.409 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1LW7 _refine.ls_d_res_high 2.90 _refine.ls_d_res_low 30.00 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 13327 _refine.ls_number_reflns_obs 12463 _refine.ls_number_reflns_R_free 1284 _refine.ls_percent_reflns_obs 91.5 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.236 _refine.ls_R_factor_R_free 0.298 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free 10.3 _refine.ls_R_factor_R_free_error 0.008 _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_bsol 41.9 _refine.solvent_model_param_ksol 0.306 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model GROUP _refine.B_iso_mean 79.1 _refine.aniso_B[1][1] 19.99 _refine.aniso_B[1][2] 27.08 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 19.99 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -39.99 _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1LW7 _refine_analyze.Luzzati_coordinate_error_obs 0.42 _refine_analyze.Luzzati_sigma_a_obs 0.58 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.56 _refine_analyze.Luzzati_sigma_a_free 0.72 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2842 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 113 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2955 _refine_hist.d_res_high 2.90 _refine_hist.d_res_low 30.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.011 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.6 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.2 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.04 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.90 _refine_ls_shell.d_res_low 3.08 _refine_ls_shell.number_reflns_R_work 1530 _refine_ls_shell.R_factor_R_work 0.384 _refine_ls_shell.percent_reflns_obs 77.4 _refine_ls_shell.R_factor_R_free 0.443 _refine_ls_shell.R_factor_R_free_error 0.033 _refine_ls_shell.percent_reflns_R_free 10.6 _refine_ls_shell.number_reflns_R_free 182 _refine_ls_shell.number_reflns_obs 1530 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _pdbx_xplor_file.serial_no 1 _pdbx_xplor_file.param_file PROTEIN_REP.PARAM _pdbx_xplor_file.topol_file PROTEIN.TOP _pdbx_xplor_file.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 1LW7 _struct.title 'NADR PROTEIN FROM HAEMOPHILUS INFLUENZAE' _struct.pdbx_descriptor 'TRANSCRIPTIONAL REGULATOR NADR' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LW7 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'NAD, NMN, NMN Adenylyl transferase, Ribosylnicotinamide kinase, TRANSFERASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 15 ? SER A 27 ? HIS A 71 SER A 83 1 ? 13 HELX_P HELX_P2 2 ASP A 39 ? SER A 50 ? ASP A 95 SER A 106 1 ? 12 HELX_P HELX_P3 3 THR A 57 ? PHE A 69 ? THR A 113 PHE A 125 1 ? 13 HELX_P HELX_P4 4 GLY A 92 ? LYS A 107 ? GLY A 148 LYS A 163 1 ? 16 HELX_P HELX_P5 5 GLU A 118 ? GLN A 120 ? GLU A 174 GLN A 176 5 ? 3 HELX_P HELX_P6 6 ASP A 121 ? LEU A 129 ? ASP A 177 LEU A 185 1 ? 9 HELX_P HELX_P7 7 SER A 146 ? THR A 153 ? SER A 202 THR A 209 1 ? 8 HELX_P HELX_P8 8 PRO A 154 ? ILE A 161 ? PRO A 210 ILE A 217 5 ? 8 HELX_P HELX_P9 9 ALA A 165 ? PHE A 169 ? ALA A 221 PHE A 225 5 ? 5 HELX_P HELX_P10 10 SER A 181 ? PHE A 194 ? SER A 237 PHE A 250 1 ? 14 HELX_P HELX_P11 11 GLY A 203 ? LYS A 210 ? GLY A 259 LYS A 266 1 ? 8 HELX_P HELX_P12 12 ASP A 222 ? SER A 241 ? ASP A 278 SER A 297 1 ? 20 HELX_P HELX_P13 13 ASP A 250 ? GLY A 263 ? ASP A 306 GLY A 319 1 ? 14 HELX_P HELX_P14 14 HIS A 266 ? TYR A 276 ? HIS A 322 TYR A 332 1 ? 11 HELX_P HELX_P15 15 GLN A 303 ? LYS A 317 ? GLN A 359 LYS A 373 1 ? 15 HELX_P HELX_P16 16 TYR A 318 ? VAL A 320 ? TYR A 374 VAL A 376 5 ? 3 HELX_P HELX_P17 17 SER A 329 ? LEU A 345 ? SER A 385 LEU A 401 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ASN 20 C ? ? ? 1_555 A MSE 21 N ? ? A ASN 76 A MSE 77 1_555 ? ? ? ? ? ? ? 1.327 ? covale2 covale ? ? A MSE 21 C ? ? ? 1_555 A ILE 22 N ? ? A MSE 77 A ILE 78 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A LYS 51 C ? ? ? 1_555 A MSE 52 N ? ? A LYS 107 A MSE 108 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale ? ? A MSE 52 C ? ? ? 1_555 A LYS 53 N ? ? A MSE 108 A LYS 109 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? A ARG 54 C ? ? ? 1_555 A MSE 55 N ? ? A ARG 110 A MSE 111 1_555 ? ? ? ? ? ? ? 1.323 ? covale6 covale ? ? A MSE 55 C ? ? ? 1_555 A PRO 56 N ? ? A MSE 111 A PRO 112 1_555 ? ? ? ? ? ? ? 1.340 ? covale7 covale ? ? A TRP 64 C ? ? ? 1_555 A MSE 65 N ? ? A TRP 120 A MSE 121 1_555 ? ? ? ? ? ? ? 1.317 ? covale8 covale ? ? A MSE 65 C ? ? ? 1_555 A GLN 66 N ? ? A MSE 121 A GLN 122 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale ? ? A GLN 225 C ? ? ? 1_555 A MSE 226 N ? ? A GLN 281 A MSE 282 1_555 ? ? ? ? ? ? ? 1.325 ? covale10 covale ? ? A MSE 226 C ? ? ? 1_555 A ALA 227 N ? ? A MSE 282 A ALA 283 1_555 ? ? ? ? ? ? ? 1.323 ? covale11 covale ? ? A SER 271 C ? ? ? 1_555 A MSE 272 N ? ? A SER 327 A MSE 328 1_555 ? ? ? ? ? ? ? 1.334 ? covale12 covale ? ? A MSE 272 C ? ? ? 1_555 A ILE 273 N ? ? A MSE 328 A ILE 329 1_555 ? ? ? ? ? ? ? 1.331 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 12 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 68 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 13 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 69 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel B 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 76 ? VAL A 82 ? ILE A 132 VAL A 138 A 2 GLU A 31 ? SER A 38 ? GLU A 87 SER A 94 A 3 VAL A 4 ? GLY A 9 ? VAL A 60 GLY A 65 A 4 ILE A 113 ? PHE A 115 ? ILE A 169 PHE A 171 A 5 GLU A 132 ? SER A 134 ? GLU A 188 SER A 190 B 1 THR A 197 ? ALA A 199 ? THR A 253 ALA A 255 B 2 ILE A 244 ? ILE A 247 ? ILE A 300 ILE A 303 B 3 LYS A 171 ? LEU A 176 ? LYS A 227 LEU A 232 B 4 VAL A 280 ? LYS A 285 ? VAL A 336 LYS A 341 B 5 ILE A 323 ? GLU A 326 ? ILE A 379 GLU A 382 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 79 ? O HIS A 135 N VAL A 36 ? N VAL A 92 A 2 3 O HIS A 33 ? O HIS A 89 N GLY A 5 ? N GLY A 61 A 3 4 N VAL A 6 ? N VAL A 62 O ILE A 113 ? O ILE A 169 A 4 5 N VAL A 114 ? N VAL A 170 O GLU A 132 ? O GLU A 188 B 1 2 N ALA A 199 ? N ALA A 255 O PHE A 246 ? O PHE A 302 B 2 3 O ILE A 247 ? O ILE A 303 N VAL A 173 ? N VAL A 229 B 3 4 N ALA A 174 ? N ALA A 230 O ILE A 282 ? O ILE A 338 B 4 5 N LEU A 283 ? N LEU A 339 O ILE A 325 ? O ILE A 381 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 501' AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 603' AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 604' AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE SO4 A 606' AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 607' AC6 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE NAD A 601' AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE NAD A 605' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 SER A 146 ? SER A 202 . ? 1_555 ? 2 AC1 5 ALA A 147 ? ALA A 203 . ? 1_555 ? 3 AC1 5 THR A 148 ? THR A 204 . ? 1_555 ? 4 AC1 5 ARG A 151 ? ARG A 207 . ? 1_555 ? 5 AC1 5 NAD G . ? NAD A 601 . ? 1_555 ? 6 AC2 2 ARG A 166 ? ARG A 222 . ? 1_555 ? 7 AC2 2 HIS A 240 ? HIS A 296 . ? 1_555 ? 8 AC3 3 LYS A 163 ? LYS A 219 . ? 1_555 ? 9 AC3 3 ARG A 239 ? ARG A 295 . ? 1_555 ? 10 AC3 3 HIS A 240 ? HIS A 296 . ? 1_555 ? 11 AC4 1 NAD H . ? NAD A 605 . ? 1_555 ? 12 AC5 3 ASN A 188 ? ASN A 244 . ? 1_555 ? 13 AC5 3 TRP A 200 ? TRP A 256 . ? 1_555 ? 14 AC5 3 NAD H . ? NAD A 605 . ? 1_555 ? 15 AC6 23 PHE A 8 ? PHE A 64 . ? 1_555 ? 16 AC6 23 GLY A 9 ? GLY A 65 . ? 1_555 ? 17 AC6 23 LYS A 10 ? LYS A 66 . ? 1_555 ? 18 AC6 23 PHE A 11 ? PHE A 67 . ? 1_555 ? 19 AC6 23 HIS A 15 ? HIS A 71 . ? 1_555 ? 20 AC6 23 HIS A 18 ? HIS A 74 . ? 1_555 ? 21 AC6 23 CYS A 37 ? CYS A 93 . ? 1_555 ? 22 AC6 23 ARG A 42 ? ARG A 98 . ? 1_555 ? 23 AC6 23 GLU A 83 ? GLU A 139 . ? 1_555 ? 24 AC6 23 PRO A 87 ? PRO A 143 . ? 1_555 ? 25 AC6 23 TYR A 89 ? TYR A 145 . ? 1_555 ? 26 AC6 23 ASN A 91 ? ASN A 147 . ? 1_555 ? 27 AC6 23 GLY A 92 ? GLY A 148 . ? 1_555 ? 28 AC6 23 TRP A 93 ? TRP A 149 . ? 1_555 ? 29 AC6 23 TRP A 96 ? TRP A 152 . ? 1_555 ? 30 AC6 23 SER A 116 ? SER A 172 . ? 1_555 ? 31 AC6 23 SER A 117 ? SER A 173 . ? 1_555 ? 32 AC6 23 GLU A 118 ? GLU A 174 . ? 1_555 ? 33 AC6 23 ASP A 137 ? ASP A 193 . ? 1_555 ? 34 AC6 23 ARG A 140 ? ARG A 196 . ? 1_555 ? 35 AC6 23 PHE A 143 ? PHE A 199 . ? 1_555 ? 36 AC6 23 VAL A 145 ? VAL A 201 . ? 1_555 ? 37 AC6 23 SO4 B . ? SO4 A 501 . ? 1_555 ? 38 AC7 9 LYS A 70 ? LYS A 126 . ? 4_765 ? 39 AC7 9 TYR A 71 ? TYR A 127 . ? 12_555 ? 40 AC7 9 SER A 198 ? SER A 254 . ? 1_555 ? 41 AC7 9 ALA A 199 ? ALA A 255 . ? 1_555 ? 42 AC7 9 TRP A 200 ? TRP A 256 . ? 1_555 ? 43 AC7 9 TYR A 233 ? TYR A 289 . ? 1_555 ? 44 AC7 9 TYR A 236 ? TYR A 292 . ? 1_555 ? 45 AC7 9 SO4 E . ? SO4 A 606 . ? 1_555 ? 46 AC7 9 SO4 F . ? SO4 A 607 . ? 1_555 ? # _database_PDB_matrix.entry_id 1LW7 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1LW7 _atom_sites.fract_transf_matrix[1][1] 0.009357 _atom_sites.fract_transf_matrix[1][2] 0.005402 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010805 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005716 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 57 57 GLU GLU A . n A 1 2 LYS 2 58 58 LYS LYS A . n A 1 3 LYS 3 59 59 LYS LYS A . n A 1 4 VAL 4 60 60 VAL VAL A . n A 1 5 GLY 5 61 61 GLY GLY A . n A 1 6 VAL 6 62 62 VAL VAL A . n A 1 7 ILE 7 63 63 ILE ILE A . n A 1 8 PHE 8 64 64 PHE PHE A . n A 1 9 GLY 9 65 65 GLY GLY A . n A 1 10 LYS 10 66 66 LYS LYS A . n A 1 11 PHE 11 67 67 PHE PHE A . n A 1 12 TYR 12 68 68 TYR TYR A . n A 1 13 PRO 13 69 69 PRO PRO A . n A 1 14 VAL 14 70 70 VAL VAL A . n A 1 15 HIS 15 71 71 HIS HIS A . n A 1 16 THR 16 72 72 THR THR A . n A 1 17 GLY 17 73 73 GLY GLY A . n A 1 18 HIS 18 74 74 HIS HIS A . n A 1 19 ILE 19 75 75 ILE ILE A . n A 1 20 ASN 20 76 76 ASN ASN A . n A 1 21 MSE 21 77 77 MSE MSE A . n A 1 22 ILE 22 78 78 ILE ILE A . n A 1 23 TYR 23 79 79 TYR TYR A . n A 1 24 GLU 24 80 80 GLU GLU A . n A 1 25 ALA 25 81 81 ALA ALA A . n A 1 26 PHE 26 82 82 PHE PHE A . n A 1 27 SER 27 83 83 SER SER A . n A 1 28 LYS 28 84 84 LYS LYS A . n A 1 29 VAL 29 85 85 VAL VAL A . n A 1 30 ASP 30 86 86 ASP ASP A . n A 1 31 GLU 31 87 87 GLU GLU A . n A 1 32 LEU 32 88 88 LEU LEU A . n A 1 33 HIS 33 89 89 HIS HIS A . n A 1 34 VAL 34 90 90 VAL VAL A . n A 1 35 ILE 35 91 91 ILE ILE A . n A 1 36 VAL 36 92 92 VAL VAL A . n A 1 37 CYS 37 93 93 CYS CYS A . n A 1 38 SER 38 94 94 SER SER A . n A 1 39 ASP 39 95 95 ASP ASP A . n A 1 40 THR 40 96 96 THR THR A . n A 1 41 VAL 41 97 97 VAL VAL A . n A 1 42 ARG 42 98 98 ARG ARG A . n A 1 43 ASP 43 99 99 ASP ASP A . n A 1 44 LEU 44 100 100 LEU LEU A . n A 1 45 LYS 45 101 101 LYS LYS A . n A 1 46 LEU 46 102 102 LEU LEU A . n A 1 47 PHE 47 103 103 PHE PHE A . n A 1 48 TYR 48 104 104 TYR TYR A . n A 1 49 ASP 49 105 105 ASP ASP A . n A 1 50 SER 50 106 106 SER SER A . n A 1 51 LYS 51 107 107 LYS LYS A . n A 1 52 MSE 52 108 108 MSE MSE A . n A 1 53 LYS 53 109 109 LYS LYS A . n A 1 54 ARG 54 110 110 ARG ARG A . n A 1 55 MSE 55 111 111 MSE MSE A . n A 1 56 PRO 56 112 112 PRO PRO A . n A 1 57 THR 57 113 113 THR THR A . n A 1 58 VAL 58 114 114 VAL VAL A . n A 1 59 GLN 59 115 115 GLN GLN A . n A 1 60 ASP 60 116 116 ASP ASP A . n A 1 61 ARG 61 117 117 ARG ARG A . n A 1 62 LEU 62 118 118 LEU LEU A . n A 1 63 ARG 63 119 119 ARG ARG A . n A 1 64 TRP 64 120 120 TRP TRP A . n A 1 65 MSE 65 121 121 MSE MSE A . n A 1 66 GLN 66 122 122 GLN GLN A . n A 1 67 GLN 67 123 123 GLN GLN A . n A 1 68 ILE 68 124 124 ILE ILE A . n A 1 69 PHE 69 125 125 PHE PHE A . n A 1 70 LYS 70 126 126 LYS LYS A . n A 1 71 TYR 71 127 127 TYR TYR A . n A 1 72 GLN 72 128 128 GLN GLN A . n A 1 73 LYS 73 129 129 LYS LYS A . n A 1 74 ASN 74 130 130 ASN ASN A . n A 1 75 GLN 75 131 131 GLN GLN A . n A 1 76 ILE 76 132 132 ILE ILE A . n A 1 77 PHE 77 133 133 PHE PHE A . n A 1 78 ILE 78 134 134 ILE ILE A . n A 1 79 HIS 79 135 135 HIS HIS A . n A 1 80 HIS 80 136 136 HIS HIS A . n A 1 81 LEU 81 137 137 LEU LEU A . n A 1 82 VAL 82 138 138 VAL VAL A . n A 1 83 GLU 83 139 139 GLU GLU A . n A 1 84 ASP 84 140 140 ASP ASP A . n A 1 85 GLY 85 141 141 GLY GLY A . n A 1 86 ILE 86 142 142 ILE ILE A . n A 1 87 PRO 87 143 143 PRO PRO A . n A 1 88 SER 88 144 144 SER SER A . n A 1 89 TYR 89 145 145 TYR TYR A . n A 1 90 PRO 90 146 146 PRO PRO A . n A 1 91 ASN 91 147 147 ASN ASN A . n A 1 92 GLY 92 148 148 GLY GLY A . n A 1 93 TRP 93 149 149 TRP TRP A . n A 1 94 GLN 94 150 150 GLN GLN A . n A 1 95 SER 95 151 151 SER SER A . n A 1 96 TRP 96 152 152 TRP TRP A . n A 1 97 SER 97 153 153 SER SER A . n A 1 98 GLU 98 154 154 GLU GLU A . n A 1 99 ALA 99 155 155 ALA ALA A . n A 1 100 VAL 100 156 156 VAL VAL A . n A 1 101 LYS 101 157 157 LYS LYS A . n A 1 102 THR 102 158 158 THR THR A . n A 1 103 LEU 103 159 159 LEU LEU A . n A 1 104 PHE 104 160 160 PHE PHE A . n A 1 105 HIS 105 161 161 HIS HIS A . n A 1 106 GLU 106 162 162 GLU GLU A . n A 1 107 LYS 107 163 163 LYS LYS A . n A 1 108 HIS 108 164 164 HIS HIS A . n A 1 109 PHE 109 165 165 PHE PHE A . n A 1 110 GLU 110 166 166 GLU GLU A . n A 1 111 PRO 111 167 167 PRO PRO A . n A 1 112 SER 112 168 168 SER SER A . n A 1 113 ILE 113 169 169 ILE ILE A . n A 1 114 VAL 114 170 170 VAL VAL A . n A 1 115 PHE 115 171 171 PHE PHE A . n A 1 116 SER 116 172 172 SER SER A . n A 1 117 SER 117 173 173 SER SER A . n A 1 118 GLU 118 174 174 GLU GLU A . n A 1 119 PRO 119 175 175 PRO PRO A . n A 1 120 GLN 120 176 176 GLN GLN A . n A 1 121 ASP 121 177 177 ASP ASP A . n A 1 122 LYS 122 178 178 LYS LYS A . n A 1 123 ALA 123 179 179 ALA ALA A . n A 1 124 PRO 124 180 180 PRO PRO A . n A 1 125 TYR 125 181 181 TYR TYR A . n A 1 126 GLU 126 182 182 GLU GLU A . n A 1 127 LYS 127 183 183 LYS LYS A . n A 1 128 TYR 128 184 184 TYR TYR A . n A 1 129 LEU 129 185 185 LEU LEU A . n A 1 130 GLY 130 186 186 GLY GLY A . n A 1 131 LEU 131 187 187 LEU LEU A . n A 1 132 GLU 132 188 188 GLU GLU A . n A 1 133 VAL 133 189 189 VAL VAL A . n A 1 134 SER 134 190 190 SER SER A . n A 1 135 LEU 135 191 191 LEU LEU A . n A 1 136 VAL 136 192 192 VAL VAL A . n A 1 137 ASP 137 193 193 ASP ASP A . n A 1 138 PRO 138 194 194 PRO PRO A . n A 1 139 ASP 139 195 195 ASP ASP A . n A 1 140 ARG 140 196 196 ARG ARG A . n A 1 141 THR 141 197 197 THR THR A . n A 1 142 PHE 142 198 198 PHE PHE A . n A 1 143 PHE 143 199 199 PHE PHE A . n A 1 144 ASN 144 200 200 ASN ASN A . n A 1 145 VAL 145 201 201 VAL VAL A . n A 1 146 SER 146 202 202 SER SER A . n A 1 147 ALA 147 203 203 ALA ALA A . n A 1 148 THR 148 204 204 THR THR A . n A 1 149 LYS 149 205 205 LYS LYS A . n A 1 150 ILE 150 206 206 ILE ILE A . n A 1 151 ARG 151 207 207 ARG ARG A . n A 1 152 THR 152 208 208 THR THR A . n A 1 153 THR 153 209 209 THR THR A . n A 1 154 PRO 154 210 210 PRO PRO A . n A 1 155 PHE 155 211 211 PHE PHE A . n A 1 156 GLN 156 212 212 GLN GLN A . n A 1 157 TYR 157 213 213 TYR TYR A . n A 1 158 TRP 158 214 214 TRP TRP A . n A 1 159 LYS 159 215 215 LYS LYS A . n A 1 160 PHE 160 216 216 PHE PHE A . n A 1 161 ILE 161 217 217 ILE ILE A . n A 1 162 PRO 162 218 218 PRO PRO A . n A 1 163 LYS 163 219 219 LYS LYS A . n A 1 164 GLU 164 220 220 GLU GLU A . n A 1 165 ALA 165 221 221 ALA ALA A . n A 1 166 ARG 166 222 222 ARG ARG A . n A 1 167 PRO 167 223 223 PRO PRO A . n A 1 168 PHE 168 224 224 PHE PHE A . n A 1 169 PHE 169 225 225 PHE PHE A . n A 1 170 ALA 170 226 226 ALA ALA A . n A 1 171 LYS 171 227 227 LYS LYS A . n A 1 172 THR 172 228 228 THR THR A . n A 1 173 VAL 173 229 229 VAL VAL A . n A 1 174 ALA 174 230 230 ALA ALA A . n A 1 175 ILE 175 231 231 ILE ILE A . n A 1 176 LEU 176 232 232 LEU LEU A . n A 1 177 GLY 177 233 233 GLY GLY A . n A 1 178 GLY 178 234 234 GLY GLY A . n A 1 179 GLU 179 235 235 GLU GLU A . n A 1 180 SER 180 236 236 SER SER A . n A 1 181 SER 181 237 237 SER SER A . n A 1 182 GLY 182 238 238 GLY GLY A . n A 1 183 LYS 183 239 239 LYS LYS A . n A 1 184 SER 184 240 240 SER SER A . n A 1 185 VAL 185 241 241 VAL VAL A . n A 1 186 LEU 186 242 242 LEU LEU A . n A 1 187 VAL 187 243 243 VAL VAL A . n A 1 188 ASN 188 244 244 ASN ASN A . n A 1 189 LYS 189 245 245 LYS LYS A . n A 1 190 LEU 190 246 246 LEU LEU A . n A 1 191 ALA 191 247 247 ALA ALA A . n A 1 192 ALA 192 248 248 ALA ALA A . n A 1 193 VAL 193 249 249 VAL VAL A . n A 1 194 PHE 194 250 250 PHE PHE A . n A 1 195 ASN 195 251 251 ASN ASN A . n A 1 196 THR 196 252 252 THR THR A . n A 1 197 THR 197 253 253 THR THR A . n A 1 198 SER 198 254 254 SER SER A . n A 1 199 ALA 199 255 255 ALA ALA A . n A 1 200 TRP 200 256 256 TRP TRP A . n A 1 201 GLU 201 257 257 GLU GLU A . n A 1 202 TYR 202 258 258 TYR TYR A . n A 1 203 GLY 203 259 259 GLY GLY A . n A 1 204 ARG 204 260 260 ARG ARG A . n A 1 205 GLU 205 261 261 GLU GLU A . n A 1 206 PHE 206 262 262 PHE PHE A . n A 1 207 VAL 207 263 263 VAL VAL A . n A 1 208 PHE 208 264 264 PHE PHE A . n A 1 209 GLU 209 265 265 GLU GLU A . n A 1 210 LYS 210 266 266 LYS LYS A . n A 1 211 LEU 211 267 267 LEU LEU A . n A 1 212 GLY 212 268 268 GLY GLY A . n A 1 213 GLY 213 269 269 GLY GLY A . n A 1 214 ASP 214 270 270 ASP ASP A . n A 1 215 GLU 215 271 271 GLU GLU A . n A 1 216 GLN 216 272 272 GLN GLN A . n A 1 217 ALA 217 273 273 ALA ALA A . n A 1 218 MET 218 274 274 MET MET A . n A 1 219 GLN 219 275 275 GLN GLN A . n A 1 220 TYR 220 276 276 TYR TYR A . n A 1 221 SER 221 277 277 SER SER A . n A 1 222 ASP 222 278 278 ASP ASP A . n A 1 223 TYR 223 279 279 TYR TYR A . n A 1 224 PRO 224 280 280 PRO PRO A . n A 1 225 GLN 225 281 281 GLN GLN A . n A 1 226 MSE 226 282 282 MSE MET A . n A 1 227 ALA 227 283 283 ALA ALA A . n A 1 228 LEU 228 284 284 LEU LEU A . n A 1 229 GLY 229 285 285 GLY GLY A . n A 1 230 HIS 230 286 286 HIS HIS A . n A 1 231 GLN 231 287 287 GLN GLN A . n A 1 232 ARG 232 288 288 ARG ARG A . n A 1 233 TYR 233 289 289 TYR TYR A . n A 1 234 ILE 234 290 290 ILE ILE A . n A 1 235 ASP 235 291 291 ASP ASP A . n A 1 236 TYR 236 292 292 TYR TYR A . n A 1 237 ALA 237 293 293 ALA ALA A . n A 1 238 VAL 238 294 294 VAL VAL A . n A 1 239 ARG 239 295 295 ARG ARG A . n A 1 240 HIS 240 296 296 HIS HIS A . n A 1 241 SER 241 297 297 SER SER A . n A 1 242 HIS 242 298 298 HIS HIS A . n A 1 243 LYS 243 299 299 LYS LYS A . n A 1 244 ILE 244 300 300 ILE ILE A . n A 1 245 ALA 245 301 301 ALA ALA A . n A 1 246 PHE 246 302 302 PHE PHE A . n A 1 247 ILE 247 303 303 ILE ILE A . n A 1 248 ASP 248 304 304 ASP ASP A . n A 1 249 THR 249 305 305 THR THR A . n A 1 250 ASP 250 306 306 ASP ASP A . n A 1 251 PHE 251 307 307 PHE PHE A . n A 1 252 ILE 252 308 308 ILE ILE A . n A 1 253 THR 253 309 309 THR THR A . n A 1 254 THR 254 310 310 THR THR A . n A 1 255 GLN 255 311 311 GLN GLN A . n A 1 256 ALA 256 312 312 ALA ALA A . n A 1 257 PHE 257 313 313 PHE PHE A . n A 1 258 CYS 258 314 314 CYS CYS A . n A 1 259 ILE 259 315 315 ILE ILE A . n A 1 260 GLN 260 316 316 GLN GLN A . n A 1 261 TYR 261 317 317 TYR TYR A . n A 1 262 GLU 262 318 318 GLU GLU A . n A 1 263 GLY 263 319 319 GLY GLY A . n A 1 264 LYS 264 320 320 LYS LYS A . n A 1 265 ALA 265 321 321 ALA ALA A . n A 1 266 HIS 266 322 322 HIS HIS A . n A 1 267 PRO 267 323 323 PRO PRO A . n A 1 268 PHE 268 324 324 PHE PHE A . n A 1 269 LEU 269 325 325 LEU LEU A . n A 1 270 ASP 270 326 326 ASP ASP A . n A 1 271 SER 271 327 327 SER SER A . n A 1 272 MSE 272 328 328 MSE MSE A . n A 1 273 ILE 273 329 329 ILE ILE A . n A 1 274 LYS 274 330 330 LYS LYS A . n A 1 275 GLU 275 331 331 GLU GLU A . n A 1 276 TYR 276 332 332 TYR TYR A . n A 1 277 PRO 277 333 333 PRO PRO A . n A 1 278 PHE 278 334 334 PHE PHE A . n A 1 279 ASP 279 335 335 ASP ASP A . n A 1 280 VAL 280 336 336 VAL VAL A . n A 1 281 THR 281 337 337 THR THR A . n A 1 282 ILE 282 338 338 ILE ILE A . n A 1 283 LEU 283 339 339 LEU LEU A . n A 1 284 LEU 284 340 340 LEU LEU A . n A 1 285 LYS 285 341 341 LYS LYS A . n A 1 286 ASN 286 342 342 ASN ASN A . n A 1 287 ASN 287 343 343 ASN ASN A . n A 1 288 THR 288 344 344 THR THR A . n A 1 289 GLU 289 345 345 GLU GLU A . n A 1 290 TRP 290 346 ? ? ? A . n A 1 291 VAL 291 347 ? ? ? A . n A 1 292 ASP 292 348 ? ? ? A . n A 1 293 ASP 293 349 ? ? ? A . n A 1 294 GLY 294 350 ? ? ? A . n A 1 295 LEU 295 351 ? ? ? A . n A 1 296 ARG 296 352 ? ? ? A . n A 1 297 SER 297 353 ? ? ? A . n A 1 298 LEU 298 354 ? ? ? A . n A 1 299 GLY 299 355 ? ? ? A . n A 1 300 SER 300 356 ? ? ? A . n A 1 301 GLN 301 357 357 GLN GLN A . n A 1 302 LYS 302 358 358 LYS LYS A . n A 1 303 GLN 303 359 359 GLN GLN A . n A 1 304 ARG 304 360 360 ARG ARG A . n A 1 305 GLN 305 361 361 GLN GLN A . n A 1 306 GLN 306 362 362 GLN GLN A . n A 1 307 PHE 307 363 363 PHE PHE A . n A 1 308 GLN 308 364 364 GLN GLN A . n A 1 309 GLN 309 365 365 GLN GLN A . n A 1 310 LEU 310 366 366 LEU LEU A . n A 1 311 LEU 311 367 367 LEU LEU A . n A 1 312 LYS 312 368 368 LYS LYS A . n A 1 313 LYS 313 369 369 LYS LYS A . n A 1 314 LEU 314 370 370 LEU LEU A . n A 1 315 LEU 315 371 371 LEU LEU A . n A 1 316 ASP 316 372 372 ASP ASP A . n A 1 317 LYS 317 373 373 LYS LYS A . n A 1 318 TYR 318 374 374 TYR TYR A . n A 1 319 LYS 319 375 375 LYS LYS A . n A 1 320 VAL 320 376 376 VAL VAL A . n A 1 321 PRO 321 377 377 PRO PRO A . n A 1 322 TYR 322 378 378 TYR TYR A . n A 1 323 ILE 323 379 379 ILE ILE A . n A 1 324 GLU 324 380 380 GLU GLU A . n A 1 325 ILE 325 381 381 ILE ILE A . n A 1 326 GLU 326 382 382 GLU GLU A . n A 1 327 SER 327 383 383 SER SER A . n A 1 328 PRO 328 384 384 PRO PRO A . n A 1 329 SER 329 385 385 SER SER A . n A 1 330 TYR 330 386 386 TYR TYR A . n A 1 331 LEU 331 387 387 LEU LEU A . n A 1 332 ASP 332 388 388 ASP ASP A . n A 1 333 ARG 333 389 389 ARG ARG A . n A 1 334 TYR 334 390 390 TYR TYR A . n A 1 335 ASN 335 391 391 ASN ASN A . n A 1 336 GLN 336 392 392 GLN GLN A . n A 1 337 VAL 337 393 393 VAL VAL A . n A 1 338 LYS 338 394 394 LYS LYS A . n A 1 339 ALA 339 395 395 ALA ALA A . n A 1 340 VAL 340 396 396 VAL VAL A . n A 1 341 ILE 341 397 397 ILE ILE A . n A 1 342 GLU 342 398 398 GLU GLU A . n A 1 343 LYS 343 399 399 LYS LYS A . n A 1 344 VAL 344 400 400 VAL VAL A . n A 1 345 LEU 345 401 401 LEU LEU A . n A 1 346 ASN 346 402 402 ASN ASN A . n A 1 347 GLU 347 403 403 GLU GLU A . n A 1 348 GLU 348 404 404 GLU ALA A . n A 1 349 GLU 349 405 405 GLU ALA A . n A 1 350 ILE 350 406 406 ILE ILE A . n A 1 351 SER 351 407 407 SER SER A . n A 1 352 GLU 352 408 408 GLU GLU A . n A 1 353 LEU 353 409 409 LEU LEU A . n A 1 354 GLN 354 410 410 GLN ALA A . n A 1 355 ASN 355 411 411 ASN ALA A . n A 1 356 THR 356 412 ? ? ? A . n A 1 357 THR 357 413 ? ? ? A . n A 1 358 PHE 358 414 ? ? ? A . n A 1 359 PRO 359 415 ? ? ? A . n A 1 360 ILE 360 416 ? ? ? A . n A 1 361 LYS 361 417 ? ? ? A . n A 1 362 GLY 362 418 ? ? ? A . n A 1 363 THR 363 419 ? ? ? A . n A 1 364 SER 364 420 ? ? ? A . n A 1 365 GLN 365 421 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 21 A MSE 77 ? MET SELENOMETHIONINE 2 A MSE 52 A MSE 108 ? MET SELENOMETHIONINE 3 A MSE 55 A MSE 111 ? MET SELENOMETHIONINE 4 A MSE 65 A MSE 121 ? MET SELENOMETHIONINE 5 A MSE 226 A MSE 282 ? MET SELENOMETHIONINE 6 A MSE 272 A MSE 328 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 22070 ? 1 MORE -305 ? 1 'SSA (A^2)' 60520 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 160.3065000000 0.0000000000 -1.0000000000 0.0000000000 92.5530009278 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 9_765 -x+2,-x+y+1,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 160.3065000000 -0.8660254038 0.5000000000 0.0000000000 92.5530009278 0.0000000000 0.0000000000 -1.0000000000 116.6300000000 4 'crystal symmetry operation' 12_555 x,x-y,-z+2/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 116.6300000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-08-07 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SCALEPACK 'data scaling' . ? 2 SOLVE phasing . ? 3 CNS refinement . ? 4 HKL-2000 'data reduction' . ? 5 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O4 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SO4 _pdbx_validate_symm_contact.auth_seq_id_1 603 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O4 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 SO4 _pdbx_validate_symm_contact.auth_seq_id_2 603 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_555 _pdbx_validate_symm_contact.dist 1.75 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LYS 266 ? ? CA A LYS 266 ? ? C A LYS 266 ? ? 94.79 111.00 -16.21 2.70 N 2 1 N A GLY 268 ? ? CA A GLY 268 ? ? C A GLY 268 ? ? 97.03 113.10 -16.07 2.50 N 3 1 C A HIS 322 ? ? N A PRO 323 ? ? CA A PRO 323 ? ? 129.19 119.30 9.89 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 58 ? ? 90.31 82.38 2 1 PRO A 69 ? ? -97.40 -153.79 3 1 THR A 96 ? ? -29.22 -55.45 4 1 GLN A 131 ? ? -140.35 -36.63 5 1 GLU A 139 ? ? -109.09 59.61 6 1 TYR A 145 ? ? -10.10 -76.19 7 1 PRO A 146 ? ? -29.49 -51.33 8 1 TRP A 149 ? ? -37.84 -36.34 9 1 HIS A 161 ? ? -93.95 -61.32 10 1 SER A 172 ? ? 174.71 -168.70 11 1 GLU A 174 ? ? 62.06 77.09 12 1 GLN A 176 ? ? -40.39 -3.89 13 1 LYS A 183 ? ? -67.63 -79.62 14 1 ASP A 193 ? ? 26.56 71.42 15 1 PHE A 199 ? ? 70.19 71.01 16 1 LYS A 215 ? ? -55.63 -6.96 17 1 ARG A 222 ? ? -24.28 -44.87 18 1 GLU A 235 ? ? -52.73 -4.74 19 1 SER A 236 ? ? -27.69 -27.20 20 1 SER A 237 ? ? 65.02 -18.17 21 1 LYS A 239 ? ? -50.26 -73.78 22 1 ASN A 251 ? ? 38.26 66.49 23 1 TRP A 256 ? ? -47.68 173.46 24 1 LYS A 266 ? ? -75.90 -169.19 25 1 LEU A 267 ? ? 67.63 -36.77 26 1 ASP A 270 ? ? -17.25 93.95 27 1 TYR A 276 ? ? -25.85 -47.84 28 1 LYS A 299 ? ? -159.09 -35.40 29 1 ASP A 304 ? ? -46.82 -83.37 30 1 CYS A 314 ? ? -51.82 -77.31 31 1 HIS A 322 ? ? 87.17 95.71 32 1 ASN A 343 ? ? -174.45 41.73 33 1 THR A 344 ? ? -164.16 115.68 34 1 LYS A 358 ? ? -134.12 -133.66 35 1 TYR A 374 ? ? 65.91 -11.73 36 1 TYR A 386 ? ? -45.00 -74.88 37 1 ASN A 402 ? ? -147.61 -90.17 38 1 GLU A 403 ? ? -49.08 -156.23 39 1 GLU A 404 ? ? -174.15 -142.45 40 1 GLU A 405 ? ? 23.42 95.91 41 1 ILE A 406 ? ? -111.54 -79.65 42 1 SER A 407 ? ? 43.16 97.71 43 1 LEU A 409 ? ? 49.93 174.36 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 404 ? CG ? A GLU 348 CG 2 1 Y 1 A GLU 404 ? CD ? A GLU 348 CD 3 1 Y 1 A GLU 404 ? OE1 ? A GLU 348 OE1 4 1 Y 1 A GLU 404 ? OE2 ? A GLU 348 OE2 5 1 Y 1 A GLU 405 ? CG ? A GLU 349 CG 6 1 Y 1 A GLU 405 ? CD ? A GLU 349 CD 7 1 Y 1 A GLU 405 ? OE1 ? A GLU 349 OE1 8 1 Y 1 A GLU 405 ? OE2 ? A GLU 349 OE2 9 1 Y 1 A GLN 410 ? CG ? A GLN 354 CG 10 1 Y 1 A GLN 410 ? CD ? A GLN 354 CD 11 1 Y 1 A GLN 410 ? OE1 ? A GLN 354 OE1 12 1 Y 1 A GLN 410 ? NE2 ? A GLN 354 NE2 13 1 Y 1 A ASN 411 ? CG ? A ASN 355 CG 14 1 Y 1 A ASN 411 ? OD1 ? A ASN 355 OD1 15 1 Y 1 A ASN 411 ? ND2 ? A ASN 355 ND2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TRP 346 ? A TRP 290 2 1 Y 1 A VAL 347 ? A VAL 291 3 1 Y 1 A ASP 348 ? A ASP 292 4 1 Y 1 A ASP 349 ? A ASP 293 5 1 Y 1 A GLY 350 ? A GLY 294 6 1 Y 1 A LEU 351 ? A LEU 295 7 1 Y 1 A ARG 352 ? A ARG 296 8 1 Y 1 A SER 353 ? A SER 297 9 1 Y 1 A LEU 354 ? A LEU 298 10 1 Y 1 A GLY 355 ? A GLY 299 11 1 Y 1 A SER 356 ? A SER 300 12 1 Y 1 A THR 412 ? A THR 356 13 1 Y 1 A THR 413 ? A THR 357 14 1 Y 1 A PHE 414 ? A PHE 358 15 1 Y 1 A PRO 415 ? A PRO 359 16 1 Y 1 A ILE 416 ? A ILE 360 17 1 Y 1 A LYS 417 ? A LYS 361 18 1 Y 1 A GLY 418 ? A GLY 362 19 1 Y 1 A THR 419 ? A THR 363 20 1 Y 1 A SER 420 ? A SER 364 21 1 Y 1 A GLN 421 ? A GLN 365 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 501 501 SO4 SO4 A . C 2 SO4 1 603 603 SO4 SO4 A . D 2 SO4 1 604 604 SO4 SO4 A . E 2 SO4 1 606 606 SO4 SO4 A . F 2 SO4 1 607 607 SO4 SO4 A . G 3 NAD 1 601 601 NAD NAD A . H 3 NAD 1 605 605 NAD NAD A . #