data_1M3B # _entry.id 1M3B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1M3B pdb_00001m3b 10.2210/pdb1m3b/pdb RCSB RCSB016544 ? ? WWPDB D_1000016544 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-08-05 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1M3B _pdbx_database_status.recvd_initial_deposition_date 2002-06-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1M30 'Solution structure of N-terminal SH3 domain from oncogene protein c-Crk' unspecified PDB 1M3A 'Solution structure of a circular form of the truncated N-terminal SH3 domain from oncogene protein c-Crk.' unspecified PDB 1M3C 'Solution structure of a circular form of the N-terminal SH3 domain from oncogene protein c-Crk' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schumann, F.H.' 1 'Varadan, R.' 2 'Tayakuniyil, P.P.' 3 'Hall, J.B.' 4 'Camarero, J.A.' 5 'Fushman, D.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Changing protein backbone topology: Structural and dynamic consequences of the backbone cyclization in SH3 domain' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'Rescuing a destabilized protein fold through backbone cyclization' J.Mol.Biol. 308 1045 1062 2001 JMOBAK UK 0022-2836 0070 ? ? 10.1006/jmbi.2001.4631 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schumann, F.H.' 1 ? primary 'Varadan, R.' 2 ? primary 'Tayakuniyil, P.P.' 3 ? primary 'Hall, J.B.' 4 ? primary 'Camarero, J.A.' 5 ? primary 'Fushman, D.' 6 ? 1 'Camarero, J.A.' 7 ? 1 'Fushman, D.' 8 ? 1 'Sato, S.' 9 ? 1 'Giriat, I.' 10 ? 1 'Cowburn, D.' 11 ? 1 'Raleigh, D.P.' 12 ? 1 'Muir, T.W.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Proto-oncogene C-crk' _entity.formula_weight 6831.592 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'R191G, E135G, A134C' _entity.pdbx_fragment 'N-TERMINAL SH3 DOMAIN (residues 134-191)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'P38, Adapter molecule crk' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG _entity_poly.pdbx_seq_one_letter_code_can CGYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 GLY n 1 3 TYR n 1 4 VAL n 1 5 ARG n 1 6 ALA n 1 7 LEU n 1 8 PHE n 1 9 ASP n 1 10 PHE n 1 11 ASN n 1 12 GLY n 1 13 ASN n 1 14 ASP n 1 15 GLU n 1 16 GLU n 1 17 ASP n 1 18 LEU n 1 19 PRO n 1 20 PHE n 1 21 LYS n 1 22 LYS n 1 23 GLY n 1 24 ASP n 1 25 ILE n 1 26 LEU n 1 27 ARG n 1 28 ILE n 1 29 ARG n 1 30 ASP n 1 31 LYS n 1 32 PRO n 1 33 GLU n 1 34 GLU n 1 35 GLN n 1 36 TRP n 1 37 TRP n 1 38 ASN n 1 39 ALA n 1 40 GLU n 1 41 ASP n 1 42 SER n 1 43 GLU n 1 44 GLY n 1 45 LYS n 1 46 ARG n 1 47 GLY n 1 48 MET n 1 49 ILE n 1 50 PRO n 1 51 VAL n 1 52 PRO n 1 53 TYR n 1 54 VAL n 1 55 GLU n 1 56 LYS n 1 57 TYR n 1 58 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene CRK _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PGEX-6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 134 134 CYS CYS A . n A 1 2 GLY 2 135 135 GLY GLY A . n A 1 3 TYR 3 136 136 TYR TYR A . n A 1 4 VAL 4 137 137 VAL VAL A . n A 1 5 ARG 5 138 138 ARG ARG A . n A 1 6 ALA 6 139 139 ALA ALA A . n A 1 7 LEU 7 140 140 LEU LEU A . n A 1 8 PHE 8 141 141 PHE PHE A . n A 1 9 ASP 9 142 142 ASP ASP A . n A 1 10 PHE 10 143 143 PHE PHE A . n A 1 11 ASN 11 144 144 ASN ASN A . n A 1 12 GLY 12 145 145 GLY GLY A . n A 1 13 ASN 13 146 146 ASN ASN A . n A 1 14 ASP 14 147 147 ASP ASP A . n A 1 15 GLU 15 148 148 GLU GLU A . n A 1 16 GLU 16 149 149 GLU GLU A . n A 1 17 ASP 17 150 150 ASP ASP A . n A 1 18 LEU 18 151 151 LEU LEU A . n A 1 19 PRO 19 152 152 PRO PRO A . n A 1 20 PHE 20 153 153 PHE PHE A . n A 1 21 LYS 21 154 154 LYS LYS A . n A 1 22 LYS 22 155 155 LYS LYS A . n A 1 23 GLY 23 156 156 GLY GLY A . n A 1 24 ASP 24 157 157 ASP ASP A . n A 1 25 ILE 25 158 158 ILE ILE A . n A 1 26 LEU 26 159 159 LEU LEU A . n A 1 27 ARG 27 160 160 ARG ARG A . n A 1 28 ILE 28 161 161 ILE ILE A . n A 1 29 ARG 29 162 162 ARG ARG A . n A 1 30 ASP 30 163 163 ASP ASP A . n A 1 31 LYS 31 164 164 LYS LYS A . n A 1 32 PRO 32 165 165 PRO PRO A . n A 1 33 GLU 33 166 166 GLU GLU A . n A 1 34 GLU 34 167 167 GLU GLU A . n A 1 35 GLN 35 168 168 GLN GLN A . n A 1 36 TRP 36 169 169 TRP TRP A . n A 1 37 TRP 37 170 170 TRP TRP A . n A 1 38 ASN 38 171 171 ASN ASN A . n A 1 39 ALA 39 172 172 ALA ALA A . n A 1 40 GLU 40 173 173 GLU GLU A . n A 1 41 ASP 41 174 174 ASP ASP A . n A 1 42 SER 42 175 175 SER SER A . n A 1 43 GLU 43 176 176 GLU GLU A . n A 1 44 GLY 44 177 177 GLY GLY A . n A 1 45 LYS 45 178 178 LYS LYS A . n A 1 46 ARG 46 179 179 ARG ARG A . n A 1 47 GLY 47 180 180 GLY GLY A . n A 1 48 MET 48 181 181 MET MET A . n A 1 49 ILE 49 182 182 ILE ILE A . n A 1 50 PRO 50 183 183 PRO PRO A . n A 1 51 VAL 51 184 184 VAL VAL A . n A 1 52 PRO 52 185 185 PRO PRO A . n A 1 53 TYR 53 186 186 TYR TYR A . n A 1 54 VAL 54 187 187 VAL VAL A . n A 1 55 GLU 55 188 188 GLU GLU A . n A 1 56 LYS 56 189 189 LYS LYS A . n A 1 57 TYR 57 190 190 TYR TYR A . n A 1 58 GLY 58 191 191 GLY GLY A . n # _exptl.entry_id 1M3B _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.crystal_id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1M3B _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1M3B _struct.title 'Solution structure of a circular form of the N-terminal SH3 domain (A134C, E135G, R191G mutant) from oncogene protein c-Crk.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1M3B _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'SH3, SH3 DOMAIN, CIRCULAR PROTEIN, CYCLIZED PROTEIN, ADAPTOR PROTEIN, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CRK_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR _struct_ref.pdbx_align_begin 134 _struct_ref.pdbx_db_accession Q64010 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1M3B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 58 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q64010 _struct_ref_seq.db_align_beg 134 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 134 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1M3B CYS A 1 ? UNP Q64010 ALA 134 'engineered mutation' 134 1 1 1M3B GLY A 2 ? UNP Q64010 GLU 135 'engineered mutation' 135 2 1 1M3B GLY A 58 ? UNP Q64010 ARG 191 'engineered mutation' 191 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id N _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 58 _struct_conn.ptnr2_label_atom_id C _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 134 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 191 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.494 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id GLY _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 58 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 134 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id GLY _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 191 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom N _pdbx_modification_feature.modified_residue_id_linking_atom C _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 46 ? PRO A 50 ? ARG A 179 PRO A 183 A 2 TRP A 36 ? ASP A 41 ? TRP A 169 ASP A 174 A 3 LYS A 22 ? ASP A 30 ? LYS A 155 ASP A 163 A 4 TYR A 3 ? LEU A 7 ? TYR A 136 LEU A 140 A 5 VAL A 54 ? GLY A 58 ? VAL A 187 GLY A 191 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 49 ? O ILE A 182 N TRP A 37 ? N TRP A 170 A 2 3 O ASN A 38 ? O ASN A 171 N ASP A 30 ? N ASP A 163 A 3 4 O LEU A 26 ? O LEU A 159 N VAL A 4 ? N VAL A 137 A 4 5 N TYR A 3 ? N TYR A 136 O GLY A 58 ? O GLY A 191 # _pdbx_entry_details.entry_id 1M3B _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A GLU 166 ? ? HE1 A TRP 170 ? ? 1.50 2 9 O A ALA 139 ? ? H A GLY 156 ? ? 1.57 3 15 O A GLU 166 ? ? HE1 A TRP 170 ? ? 1.60 4 17 O A ASP 147 ? ? H A ASP 150 ? ? 1.59 5 19 O A ASP 147 ? ? H A GLU 149 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 146 ? ? -159.47 60.66 2 1 GLU A 148 ? ? -86.63 39.16 3 1 GLU A 149 ? ? -144.49 -39.73 4 1 GLN A 168 ? ? -155.40 -49.93 5 1 ASP A 174 ? ? -57.41 176.69 6 2 ASN A 146 ? ? 176.38 48.20 7 2 GLU A 148 ? ? -81.64 45.87 8 2 GLU A 149 ? ? -160.41 -37.63 9 2 GLN A 168 ? ? -171.67 -60.89 10 2 ASP A 174 ? ? -55.02 171.07 11 2 SER A 175 ? ? -77.94 29.93 12 3 PHE A 141 ? ? -170.62 135.14 13 3 ASN A 146 ? ? -173.70 -58.64 14 3 ASP A 147 ? ? 166.09 123.91 15 3 GLN A 168 ? ? 170.15 -66.52 16 3 SER A 175 ? ? -80.59 31.61 17 4 PHE A 141 ? ? -165.20 118.45 18 4 ASN A 146 ? ? 178.03 -36.36 19 4 GLU A 148 ? ? -87.06 31.71 20 4 LYS A 155 ? ? -47.16 106.77 21 4 GLN A 168 ? ? 79.43 -51.95 22 4 TYR A 190 ? ? -111.18 75.34 23 5 TYR A 136 ? ? -144.45 -144.83 24 5 LEU A 140 ? ? -99.51 40.11 25 5 ASN A 146 ? ? -179.05 74.55 26 5 GLU A 148 ? ? -86.14 43.18 27 5 GLU A 149 ? ? -154.83 -41.00 28 5 GLU A 166 ? ? -51.61 176.67 29 5 GLN A 168 ? ? -175.84 -56.71 30 5 ASP A 174 ? ? -54.39 173.43 31 6 LEU A 140 ? ? -106.12 42.17 32 6 ASN A 146 ? ? -174.34 -45.24 33 6 GLU A 148 ? ? -86.02 39.34 34 6 ARG A 162 ? ? -101.24 -64.87 35 6 LYS A 164 ? ? 84.78 100.14 36 6 GLU A 166 ? ? 30.99 -145.73 37 6 GLU A 167 ? ? -165.74 44.96 38 6 GLN A 168 ? ? -175.23 -60.61 39 6 ASP A 174 ? ? -57.33 172.55 40 6 TYR A 186 ? ? -84.99 40.58 41 7 LEU A 140 ? ? -107.77 47.45 42 7 PHE A 141 ? ? 178.12 134.40 43 7 ASN A 146 ? ? 178.57 43.55 44 7 ASP A 147 ? ? 54.72 174.22 45 7 GLU A 149 ? ? 178.60 -34.95 46 7 ASP A 150 ? ? 167.81 124.83 47 7 GLN A 168 ? ? 76.27 -52.45 48 7 ASP A 174 ? ? -56.70 173.78 49 7 TYR A 186 ? ? -91.55 33.74 50 8 LEU A 140 ? ? -97.86 41.63 51 8 ASN A 146 ? ? 177.34 38.42 52 8 ASP A 147 ? ? 74.70 42.90 53 8 GLU A 148 ? ? -98.36 46.91 54 8 LYS A 155 ? ? -52.35 109.22 55 8 GLU A 166 ? ? -78.74 -168.34 56 8 GLN A 168 ? ? 162.04 -60.26 57 8 ASP A 174 ? ? -59.04 175.95 58 8 TYR A 186 ? ? -88.90 44.38 59 9 LEU A 140 ? ? -104.44 43.72 60 9 ASN A 146 ? ? 169.69 -54.84 61 9 GLU A 148 ? ? -85.97 36.55 62 9 GLU A 166 ? ? -61.80 -175.83 63 9 GLN A 168 ? ? 154.83 -74.49 64 9 SER A 175 ? ? -81.74 31.41 65 10 ASN A 146 ? ? -170.00 -42.82 66 10 GLU A 166 ? ? -60.83 -178.10 67 10 GLN A 168 ? ? -153.62 -45.01 68 10 ASP A 174 ? ? -52.14 179.59 69 10 TYR A 186 ? ? -90.95 30.65 70 11 PHE A 141 ? ? -174.48 125.08 71 11 ASN A 146 ? ? -177.94 -61.77 72 11 ASP A 147 ? ? -176.97 124.04 73 11 LYS A 155 ? ? -56.16 102.34 74 11 GLN A 168 ? ? -148.97 -47.58 75 11 ASP A 174 ? ? -55.37 178.22 76 12 LEU A 140 ? ? -108.54 45.37 77 12 PHE A 141 ? ? -171.73 125.72 78 12 ASN A 146 ? ? -178.53 -42.18 79 12 GLU A 148 ? ? -85.67 35.37 80 12 GLU A 167 ? ? -113.80 57.55 81 12 GLN A 168 ? ? -170.73 -67.84 82 13 LEU A 140 ? ? -94.27 41.19 83 13 PHE A 141 ? ? -178.90 130.42 84 13 ASN A 144 ? ? 176.01 141.77 85 13 ASN A 146 ? ? -171.67 -46.08 86 13 GLU A 148 ? ? -83.93 38.02 87 13 GLU A 149 ? ? -160.52 39.85 88 13 PHE A 153 ? ? -109.11 -163.53 89 13 LYS A 154 ? ? -177.44 147.37 90 13 LYS A 164 ? ? -150.44 58.44 91 13 GLN A 168 ? ? 85.49 -56.97 92 13 SER A 175 ? ? -77.19 28.79 93 14 TYR A 136 ? ? -109.25 -151.87 94 14 PHE A 141 ? ? -173.96 131.43 95 14 ASN A 146 ? ? 177.72 47.99 96 14 GLU A 148 ? ? -80.50 47.72 97 14 GLU A 149 ? ? -165.96 -39.02 98 14 LYS A 164 ? ? -156.58 63.78 99 14 GLN A 168 ? ? 171.73 -67.83 100 14 ASP A 174 ? ? -55.75 174.88 101 15 LEU A 140 ? ? -103.26 43.67 102 15 PHE A 141 ? ? -174.52 121.36 103 15 ASN A 144 ? ? -103.45 -79.94 104 15 ASN A 146 ? ? 164.47 88.68 105 15 ASP A 147 ? ? -40.82 160.93 106 15 GLU A 148 ? ? -76.88 44.58 107 15 GLU A 149 ? ? -140.70 -36.82 108 15 PRO A 165 ? ? -74.95 -76.35 109 15 GLU A 166 ? ? -51.92 179.06 110 15 GLN A 168 ? ? -155.03 -43.35 111 15 SER A 175 ? ? -75.79 30.19 112 16 LEU A 140 ? ? -109.37 48.08 113 16 ASN A 146 ? ? -178.32 37.22 114 16 ASP A 147 ? ? 54.44 170.61 115 16 GLU A 148 ? ? 69.94 -60.94 116 16 ASP A 150 ? ? 179.80 149.35 117 16 LYS A 164 ? ? -155.48 57.51 118 16 PRO A 165 ? ? -75.01 40.16 119 16 GLN A 168 ? ? 176.14 -62.88 120 16 ASP A 174 ? ? -57.29 172.72 121 16 SER A 175 ? ? -79.54 27.60 122 17 LEU A 140 ? ? -108.31 46.52 123 17 PHE A 141 ? ? -171.87 119.88 124 17 ASN A 144 ? ? -70.08 -71.12 125 17 ASN A 146 ? ? 172.57 39.16 126 17 GLU A 148 ? ? -38.35 -39.15 127 17 ARG A 162 ? ? -122.63 -52.68 128 17 GLN A 168 ? ? 78.65 -51.90 129 17 ASP A 174 ? ? -53.35 171.27 130 17 SER A 175 ? ? -77.55 29.89 131 18 ASN A 144 ? ? -174.31 77.48 132 18 ASN A 146 ? ? 173.90 -53.97 133 18 ASP A 147 ? ? -170.12 119.26 134 18 GLN A 168 ? ? -172.81 -65.72 135 18 SER A 175 ? ? -83.34 30.53 136 18 TYR A 190 ? ? -123.13 -67.10 137 19 LEU A 140 ? ? -119.77 50.30 138 19 PHE A 141 ? ? -178.23 133.17 139 19 ASN A 144 ? ? -103.43 -74.78 140 19 ASN A 146 ? ? 160.76 51.59 141 19 GLU A 148 ? ? 66.69 -58.23 142 19 LEU A 151 ? ? -39.61 110.39 143 19 ARG A 162 ? ? -120.54 -59.30 144 19 GLN A 168 ? ? 81.39 -54.54 145 19 ASP A 174 ? ? -56.14 171.36 146 19 TYR A 190 ? ? -157.90 82.54 147 20 ASN A 146 ? ? 174.20 68.11 148 20 GLU A 148 ? ? -79.78 42.26 149 20 GLU A 149 ? ? -142.99 -41.84 150 20 GLN A 168 ? ? 78.51 -51.91 151 20 ASP A 174 ? ? -49.63 170.74 # _pdbx_nmr_ensemble.entry_id 1M3B _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1M3B _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM SH3 NA, 20mM sodium phosphate, 20 mM DTT-d10, 100 mM NaCl, 0.1% (w/v) NaN3' '90% H2O/10% D2O' 2 '1mM SH3 U-15N, 20mM sodium phosphate, 20 mM DTT-d10, 100 mM NaCl, 0.1% (w/v) NaN3' '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 307 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength '100 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 2 1 1 '2D NOESY' 3 1 1 DQF-COSY 4 2 1 '2D HSQC' 5 2 1 '2D TOCSY' # _pdbx_nmr_details.entry_id 1M3B _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques combined with 2D 1H-15N HSQC data.' # _pdbx_nmr_refine.entry_id 1M3B _pdbx_nmr_refine.method 'Simulated annealing combined with torsion angle dynamics' _pdbx_nmr_refine.details ;The structures are based on 1151 restraints, 1054 are NOE-derived distance contraints, 25 dihedral angle constraints, and 72 distance restraints from hydrogen bonds. Structures were calculated using program DYANA. No further refinement was performed. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6,3.0 collection Bruker 1 XEASY 1.3.1.3 'data analysis' 'Bartels, Xia, Wuethrich' 2 DYANA 1.5 'structure solution' Guentert 3 DYANA ? refinement 'Guentert, Wuethrich' 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 TRP N N N N 280 TRP CA C N S 281 TRP C C N N 282 TRP O O N N 283 TRP CB C N N 284 TRP CG C Y N 285 TRP CD1 C Y N 286 TRP CD2 C Y N 287 TRP NE1 N Y N 288 TRP CE2 C Y N 289 TRP CE3 C Y N 290 TRP CZ2 C Y N 291 TRP CZ3 C Y N 292 TRP CH2 C Y N 293 TRP OXT O N N 294 TRP H H N N 295 TRP H2 H N N 296 TRP HA H N N 297 TRP HB2 H N N 298 TRP HB3 H N N 299 TRP HD1 H N N 300 TRP HE1 H N N 301 TRP HE3 H N N 302 TRP HZ2 H N N 303 TRP HZ3 H N N 304 TRP HH2 H N N 305 TRP HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 TRP N CA sing N N 267 TRP N H sing N N 268 TRP N H2 sing N N 269 TRP CA C sing N N 270 TRP CA CB sing N N 271 TRP CA HA sing N N 272 TRP C O doub N N 273 TRP C OXT sing N N 274 TRP CB CG sing N N 275 TRP CB HB2 sing N N 276 TRP CB HB3 sing N N 277 TRP CG CD1 doub Y N 278 TRP CG CD2 sing Y N 279 TRP CD1 NE1 sing Y N 280 TRP CD1 HD1 sing N N 281 TRP CD2 CE2 doub Y N 282 TRP CD2 CE3 sing Y N 283 TRP NE1 CE2 sing Y N 284 TRP NE1 HE1 sing N N 285 TRP CE2 CZ2 sing Y N 286 TRP CE3 CZ3 doub Y N 287 TRP CE3 HE3 sing N N 288 TRP CZ2 CH2 doub Y N 289 TRP CZ2 HZ2 sing N N 290 TRP CZ3 CH2 sing Y N 291 TRP CZ3 HZ3 sing N N 292 TRP CH2 HH2 sing N N 293 TRP OXT HXT sing N N 294 TYR N CA sing N N 295 TYR N H sing N N 296 TYR N H2 sing N N 297 TYR CA C sing N N 298 TYR CA CB sing N N 299 TYR CA HA sing N N 300 TYR C O doub N N 301 TYR C OXT sing N N 302 TYR CB CG sing N N 303 TYR CB HB2 sing N N 304 TYR CB HB3 sing N N 305 TYR CG CD1 doub Y N 306 TYR CG CD2 sing Y N 307 TYR CD1 CE1 sing Y N 308 TYR CD1 HD1 sing N N 309 TYR CD2 CE2 doub Y N 310 TYR CD2 HD2 sing N N 311 TYR CE1 CZ doub Y N 312 TYR CE1 HE1 sing N N 313 TYR CE2 CZ sing Y N 314 TYR CE2 HE2 sing N N 315 TYR CZ OH sing N N 316 TYR OH HH sing N N 317 TYR OXT HXT sing N N 318 VAL N CA sing N N 319 VAL N H sing N N 320 VAL N H2 sing N N 321 VAL CA C sing N N 322 VAL CA CB sing N N 323 VAL CA HA sing N N 324 VAL C O doub N N 325 VAL C OXT sing N N 326 VAL CB CG1 sing N N 327 VAL CB CG2 sing N N 328 VAL CB HB sing N N 329 VAL CG1 HG11 sing N N 330 VAL CG1 HG12 sing N N 331 VAL CG1 HG13 sing N N 332 VAL CG2 HG21 sing N N 333 VAL CG2 HG22 sing N N 334 VAL CG2 HG23 sing N N 335 VAL OXT HXT sing N N 336 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 3 ? Bruker DRX 600 # _atom_sites.entry_id 1M3B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_