data_1MR0 # _entry.id 1MR0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1MR0 pdb_00001mr0 10.2210/pdb1mr0/pdb RCSB RCSB017121 ? ? WWPDB D_1000017121 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2002-10-02 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-27 5 'Structure model' 1 4 2024-10-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.pdb_id 1MR0 _pdbx_database_PDB_obs_spr.replace_pdb_id 1MC6 _pdbx_database_PDB_obs_spr.date 2002-10-02 _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1MR0 _pdbx_database_status.recvd_initial_deposition_date 2002-09-17 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1HYK 'AGRP(87-132)' unspecified PDB 1MC6 'AGRP(87-120:C105A) Non-superimposed structures, same structure family' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jackson, P.J.' 1 'Mcnulty, J.C.' 2 'Yang, Y.K.' 3 'Thompson, D.A.' 4 'Chai, B.' 5 'Gantz, I.' 6 'Barsh, G.S.' 7 'Millhauser, G.M.' 8 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity.' Biochemistry 41 7565 7572 2002 BICHAW US 0006-2960 0033 ? 12056887 10.1021/bi012000x 1 ;High Resolution NMR Structure of the Chemically-Synthesized Melanocortin Receptor Binding Domain of Agrp(87-132) of the Agouti-Related Protein. ; Biochemistry 40 15520 15527 2001 BICHAW US 0006-2960 0033 ? ? 10.1021/bi0117192 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jackson, P.J.' 1 ? primary 'McNulty, J.C.' 2 ? primary 'Yang, Y.K.' 3 ? primary 'Thompson, D.A.' 4 ? primary 'Chai, B.' 5 ? primary 'Gantz, I.' 6 ? primary 'Barsh, G.S.' 7 ? primary 'Millhauser, G.L.' 8 ? 1 'Mcnulty, J.C.' 9 ? 1 'Thompson, D.A.' 10 ? 1 'Bolin, K.A.' 11 ? 1 'Wilken, J.' 12 ? 1 'Barsh, G.S.' 13 ? 1 'Millhauser, G.M.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'AGOUTI RELATED PROTEIN' _entity.formula_weight 3912.590 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C105A _entity.pdbx_fragment 'RESIDUES 87-120' _entity.details ;THIS IS A RATIONALLY MINIMIZED FRAGMENT OF THE FULLY ACTIVE C-TERMINAL DOMAIN OF THE HUMAN AGOUTI-RELATED PROTEIN AGRP(87-132). THIS FRAGMENT HAS REMOVED FROM IT THE LARGELY DISORDERED C-TERMINAL 12 RESIDUES, YET RETAINS THE SAME BASIC STRUCTURAL AND FUNCTIONAL CHARACTERISTICS OF THE LARGER FRAGMENT. ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code CVRLHESCLGQQVPCCDPAATCYCRFFNAFCYCR _entity_poly.pdbx_seq_one_letter_code_can CVRLHESCLGQQVPCCDPAATCYCRFFNAFCYCR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 CYS n 1 2 VAL n 1 3 ARG n 1 4 LEU n 1 5 HIS n 1 6 GLU n 1 7 SER n 1 8 CYS n 1 9 LEU n 1 10 GLY n 1 11 GLN n 1 12 GLN n 1 13 VAL n 1 14 PRO n 1 15 CYS n 1 16 CYS n 1 17 ASP n 1 18 PRO n 1 19 ALA n 1 20 ALA n 1 21 THR n 1 22 CYS n 1 23 TYR n 1 24 CYS n 1 25 ARG n 1 26 PHE n 1 27 PHE n 1 28 ASN n 1 29 ALA n 1 30 PHE n 1 31 CYS n 1 32 TYR n 1 33 CYS n 1 34 ARG n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;THE PROTEIN WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PROTEIN IS NATURALLY FOUND IN HOMO SAPIENS. THE SYNTHETIC METHOD IS STANDARD SOLID-PHASE SYNTHESIS FOLLOWED BY AQUEOUS OXIDATIVE FOLDING. ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 CYS 1 1 1 CYS CYS A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 ARG 34 34 34 ARG ARG A . n # _cell.entry_id 1MR0 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1MR0 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1MR0 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1MR0 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1MR0 _struct.title 'SOLUTION NMR STRUCTURE OF AGRP(87-120; C105A)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1MR0 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'RATIONAL PROTEIN DESIGN, ICK, INHIBITOR CYSTINE KNOT, AGRP, AGOUTI-RELATED PROTEIN, MELANOCORTIN, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AGRP_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR _struct_ref.pdbx_align_begin 87 _struct_ref.pdbx_db_accession O00253 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1MR0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 34 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00253 _struct_ref_seq.db_align_beg 87 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 120 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 34 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 1MR0 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 19 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O00253 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 105 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 19 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 1 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 1 A CYS 16 1_555 ? ? ? ? ? ? ? 1.997 ? ? disulf2 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 8 A CYS 22 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 15 A CYS 33 1_555 ? ? ? ? ? ? ? 1.993 ? ? disulf4 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 31 SG ? ? A CYS 24 A CYS 31 1_555 ? ? ? ? ? ? ? 1.982 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 1 ? CYS A 16 ? CYS A 1 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 8 ? CYS A 22 ? CYS A 8 ? 1_555 CYS A 22 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 15 ? CYS A 33 ? CYS A 15 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 24 ? CYS A 31 ? CYS A 24 ? 1_555 CYS A 31 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 21 ? CYS A 24 ? THR A 21 CYS A 24 A 2 CYS A 31 ? ARG A 34 ? CYS A 31 ARG A 34 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 23 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # _pdbx_entry_details.entry_id 1MR0 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A VAL 2 ? ? H A CYS 16 ? ? 1.52 2 7 O A VAL 2 ? ? H A CYS 16 ? ? 1.58 3 8 H A ARG 3 ? ? OE1 A GLU 6 ? ? 1.55 4 9 O A VAL 2 ? ? H A CYS 16 ? ? 1.56 5 12 H A ARG 3 ? ? OE1 A GLU 6 ? ? 1.52 6 13 H A ARG 3 ? ? OE1 A GLU 6 ? ? 1.57 7 15 O A VAL 2 ? ? H A CYS 16 ? ? 1.53 8 19 O A VAL 2 ? ? H A CYS 16 ? ? 1.54 9 22 O A VAL 2 ? ? H A CYS 16 ? ? 1.55 10 23 H A VAL 2 ? ? O A PRO 14 ? ? 1.59 11 23 O A VAL 2 ? ? H A CYS 16 ? ? 1.59 12 26 O A VAL 2 ? ? H A CYS 16 ? ? 1.57 13 29 H A ARG 3 ? ? OE1 A GLU 6 ? ? 1.54 14 31 O A VAL 2 ? ? H A CYS 16 ? ? 1.50 15 31 H A VAL 2 ? ? O A PRO 14 ? ? 1.57 16 33 HG1 A THR 21 ? ? O A ARG 34 ? ? 1.59 17 36 O A VAL 2 ? ? H A CYS 16 ? ? 1.50 18 38 H A VAL 2 ? ? O A PRO 14 ? ? 1.54 19 40 O A VAL 2 ? ? H A CYS 16 ? ? 1.52 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 5 ? ? -84.40 46.37 2 1 SER A 7 ? ? -39.46 156.54 3 1 LEU A 9 ? ? -38.71 115.59 4 1 CYS A 22 ? ? -65.92 91.22 5 1 PHE A 26 ? ? -90.35 -156.64 6 1 ALA A 29 ? ? -148.56 -85.50 7 2 HIS A 5 ? ? -86.09 45.62 8 2 SER A 7 ? ? -37.61 148.89 9 2 CYS A 22 ? ? -61.15 84.43 10 2 PHE A 26 ? ? -83.58 -154.68 11 2 ALA A 29 ? ? -155.79 -72.62 12 3 HIS A 5 ? ? -86.67 45.43 13 3 SER A 7 ? ? -32.00 141.43 14 3 PHE A 26 ? ? -78.66 -156.39 15 3 ALA A 29 ? ? -155.59 -79.80 16 4 HIS A 5 ? ? -93.35 44.75 17 4 SER A 7 ? ? -37.16 154.56 18 4 CYS A 22 ? ? -60.58 84.35 19 4 PHE A 26 ? ? -80.72 -155.60 20 4 ALA A 29 ? ? -155.42 -80.01 21 5 HIS A 5 ? ? -87.96 45.87 22 5 SER A 7 ? ? -36.97 154.61 23 5 LEU A 9 ? ? -39.91 117.43 24 5 CYS A 22 ? ? -61.23 82.32 25 5 PHE A 26 ? ? -91.31 -157.13 26 5 ALA A 29 ? ? -155.89 -39.17 27 6 HIS A 5 ? ? -97.17 47.15 28 6 SER A 7 ? ? -35.14 150.95 29 6 CYS A 22 ? ? -62.01 83.60 30 6 PHE A 26 ? ? -80.31 -156.66 31 6 ALA A 29 ? ? -155.43 -79.27 32 7 HIS A 5 ? ? -85.16 45.61 33 7 SER A 7 ? ? -36.33 151.56 34 7 CYS A 22 ? ? -63.96 85.31 35 7 PHE A 26 ? ? -80.98 -156.13 36 7 ALA A 29 ? ? -155.60 -78.11 37 8 HIS A 5 ? ? -84.99 47.14 38 8 SER A 7 ? ? -34.09 149.30 39 8 CYS A 22 ? ? -61.85 83.22 40 8 PHE A 26 ? ? -80.38 -156.38 41 8 ALA A 29 ? ? -155.57 -79.44 42 9 HIS A 5 ? ? -95.57 48.68 43 9 SER A 7 ? ? -40.38 157.38 44 9 LEU A 9 ? ? -47.77 106.10 45 9 CYS A 22 ? ? -57.81 84.63 46 9 PHE A 26 ? ? -80.13 -156.23 47 9 ALA A 29 ? ? -155.51 -79.04 48 10 HIS A 5 ? ? -92.25 46.57 49 10 SER A 7 ? ? -42.08 158.39 50 10 LEU A 9 ? ? -45.07 107.29 51 10 PRO A 18 ? ? -75.09 -83.62 52 10 ALA A 19 ? ? -84.32 46.15 53 10 CYS A 22 ? ? -58.38 86.32 54 10 PHE A 26 ? ? -80.75 -156.23 55 10 ALA A 29 ? ? -155.42 -72.45 56 11 HIS A 5 ? ? -84.94 45.81 57 11 SER A 7 ? ? -37.57 153.60 58 11 LEU A 9 ? ? -37.57 116.31 59 11 ALA A 19 ? ? -91.82 30.99 60 11 CYS A 22 ? ? -61.37 80.08 61 11 PHE A 26 ? ? -116.04 -165.91 62 11 ALA A 29 ? ? -155.57 -94.91 63 12 HIS A 5 ? ? -86.27 46.13 64 12 SER A 7 ? ? -34.96 150.91 65 12 CYS A 22 ? ? -60.92 82.87 66 12 PHE A 26 ? ? -96.95 -156.19 67 12 ALA A 29 ? ? -156.03 -39.79 68 13 HIS A 5 ? ? -84.84 45.36 69 13 SER A 7 ? ? -35.36 145.75 70 13 CYS A 22 ? ? -60.95 84.80 71 13 PHE A 26 ? ? -79.55 -154.53 72 13 ASN A 28 ? ? -146.91 29.05 73 13 ALA A 29 ? ? -96.04 -84.87 74 14 HIS A 5 ? ? -89.98 44.48 75 14 SER A 7 ? ? -37.23 154.81 76 14 LEU A 9 ? ? -37.14 111.81 77 14 PRO A 18 ? ? -74.93 -83.81 78 14 CYS A 22 ? ? -59.86 86.47 79 14 PHE A 26 ? ? -81.02 -156.42 80 14 ALA A 29 ? ? -155.39 -70.51 81 15 HIS A 5 ? ? -86.49 45.05 82 15 SER A 7 ? ? -39.41 153.39 83 15 LEU A 9 ? ? -37.51 119.75 84 15 CYS A 22 ? ? -64.26 84.18 85 15 PHE A 26 ? ? -79.71 -156.01 86 15 ALA A 29 ? ? -155.55 -79.78 87 16 HIS A 5 ? ? -85.58 45.22 88 16 SER A 7 ? ? -34.26 143.97 89 16 ALA A 19 ? ? -92.69 32.99 90 16 CYS A 22 ? ? -60.61 80.63 91 16 PHE A 26 ? ? -113.67 -165.00 92 16 ALA A 29 ? ? -155.64 -94.98 93 17 HIS A 5 ? ? -88.94 45.89 94 17 SER A 7 ? ? -34.76 150.91 95 17 ALA A 19 ? ? -92.06 30.49 96 17 CYS A 22 ? ? -63.67 79.47 97 17 PHE A 26 ? ? -87.93 -155.89 98 17 ALA A 29 ? ? -150.12 -84.42 99 18 HIS A 5 ? ? -96.81 45.83 100 18 SER A 7 ? ? -46.69 152.95 101 18 CYS A 22 ? ? -60.42 81.68 102 18 PHE A 26 ? ? -80.86 -155.75 103 18 ALA A 29 ? ? -155.79 -70.46 104 19 HIS A 5 ? ? -85.75 46.63 105 19 SER A 7 ? ? -39.11 155.13 106 19 LEU A 9 ? ? -36.93 127.02 107 19 CYS A 22 ? ? -60.04 83.96 108 19 PHE A 26 ? ? -81.61 -155.90 109 19 ALA A 29 ? ? -155.64 -80.26 110 20 HIS A 5 ? ? -84.85 46.03 111 20 SER A 7 ? ? -37.76 155.93 112 20 CYS A 22 ? ? -66.84 89.72 113 20 PHE A 26 ? ? -89.67 -154.47 114 20 ALA A 29 ? ? -145.04 -78.79 115 21 HIS A 5 ? ? -84.04 47.15 116 21 SER A 7 ? ? -37.66 152.74 117 21 ALA A 19 ? ? -95.40 38.99 118 21 CYS A 22 ? ? -51.60 87.85 119 21 PHE A 26 ? ? -79.39 -157.58 120 21 ALA A 29 ? ? -153.53 -71.87 121 22 HIS A 5 ? ? -86.85 44.92 122 22 CYS A 22 ? ? -59.13 85.43 123 22 PHE A 26 ? ? -93.29 -156.19 124 22 ALA A 29 ? ? -156.17 -40.04 125 23 HIS A 5 ? ? -96.50 47.17 126 23 SER A 7 ? ? -43.73 154.70 127 23 LEU A 9 ? ? -40.00 111.39 128 23 CYS A 22 ? ? -47.12 90.07 129 23 PHE A 26 ? ? -118.16 -166.67 130 23 ALA A 29 ? ? -155.21 -95.35 131 24 HIS A 5 ? ? -86.80 45.87 132 24 SER A 7 ? ? -34.30 147.59 133 24 ALA A 19 ? ? -91.53 30.53 134 24 CYS A 22 ? ? -61.87 82.46 135 24 ALA A 29 ? ? -155.39 -83.69 136 25 HIS A 5 ? ? -84.38 46.20 137 25 SER A 7 ? ? -36.40 153.24 138 25 LEU A 9 ? ? -39.12 110.67 139 25 ALA A 19 ? ? -93.02 33.66 140 25 CYS A 22 ? ? -59.31 83.65 141 25 PHE A 26 ? ? -115.54 -164.10 142 25 ALA A 29 ? ? -155.84 -48.55 143 26 HIS A 5 ? ? -84.74 46.04 144 26 SER A 7 ? ? -39.58 160.29 145 26 LEU A 9 ? ? -38.94 100.39 146 26 CYS A 22 ? ? -63.74 84.55 147 26 PHE A 26 ? ? -83.45 -155.45 148 26 ALA A 29 ? ? -155.56 -71.19 149 27 HIS A 5 ? ? -97.57 46.90 150 27 SER A 7 ? ? -47.94 157.20 151 27 LEU A 9 ? ? -39.58 113.26 152 27 PRO A 18 ? ? -75.01 -84.66 153 27 ALA A 19 ? ? -84.93 45.62 154 27 CYS A 22 ? ? -55.71 88.37 155 27 PHE A 26 ? ? -110.77 -166.08 156 27 ALA A 29 ? ? -155.48 -92.81 157 28 HIS A 5 ? ? -85.55 45.74 158 28 SER A 7 ? ? -31.73 145.10 159 28 CYS A 22 ? ? -66.06 81.52 160 28 PHE A 26 ? ? -97.16 -157.61 161 28 ALA A 29 ? ? -155.48 -78.78 162 29 HIS A 5 ? ? -84.91 45.69 163 29 SER A 7 ? ? -32.58 145.31 164 29 ALA A 19 ? ? -94.61 30.65 165 29 CYS A 22 ? ? -62.07 80.04 166 29 PHE A 26 ? ? -103.70 -158.67 167 29 ALA A 29 ? ? -155.54 -86.91 168 30 HIS A 5 ? ? -87.68 43.05 169 30 SER A 7 ? ? -36.71 146.69 170 30 PRO A 18 ? ? -75.04 -83.97 171 30 CYS A 22 ? ? -62.67 86.08 172 30 PHE A 26 ? ? -95.81 -156.57 173 30 ALA A 29 ? ? -155.79 -40.39 174 31 HIS A 5 ? ? -83.38 49.85 175 31 SER A 7 ? ? -40.46 155.91 176 31 LEU A 9 ? ? -43.12 96.89 177 31 CYS A 22 ? ? -57.65 88.22 178 31 PHE A 26 ? ? -88.50 -155.38 179 31 ALA A 29 ? ? -147.82 -83.70 180 32 HIS A 5 ? ? -84.04 48.00 181 32 SER A 7 ? ? -38.08 153.28 182 32 LEU A 9 ? ? -37.91 105.41 183 32 CYS A 22 ? ? -57.81 86.54 184 32 PHE A 26 ? ? -87.53 -151.09 185 32 ASN A 28 ? ? -148.62 30.12 186 33 HIS A 5 ? ? -89.43 47.52 187 33 SER A 7 ? ? -40.16 152.59 188 33 LEU A 9 ? ? -38.70 118.11 189 33 ALA A 19 ? ? -95.17 31.98 190 33 CYS A 22 ? ? -61.82 81.73 191 33 PHE A 26 ? ? -93.27 -159.72 192 33 ALA A 29 ? ? -155.49 -72.43 193 34 HIS A 5 ? ? -83.72 47.46 194 34 SER A 7 ? ? -39.11 153.39 195 34 ALA A 19 ? ? -93.36 34.20 196 34 CYS A 22 ? ? -62.24 81.02 197 34 PHE A 26 ? ? -80.47 -156.58 198 34 ALA A 29 ? ? -155.61 -77.70 199 35 HIS A 5 ? ? -86.11 45.67 200 35 SER A 7 ? ? -32.73 146.77 201 35 CYS A 22 ? ? -61.42 83.96 202 35 PHE A 26 ? ? -91.37 -156.86 203 35 ALA A 29 ? ? -155.96 -39.05 204 36 HIS A 5 ? ? -84.75 46.24 205 36 SER A 7 ? ? -38.01 151.39 206 36 CYS A 22 ? ? -65.76 75.49 207 36 PHE A 26 ? ? -88.29 -155.90 208 36 ALA A 29 ? ? -150.11 -83.73 209 37 HIS A 5 ? ? -86.60 45.34 210 37 LEU A 9 ? ? -55.85 95.47 211 37 ALA A 19 ? ? -93.54 35.50 212 37 CYS A 22 ? ? -57.72 85.97 213 37 PHE A 26 ? ? -85.98 -155.97 214 37 ALA A 29 ? ? -155.56 -71.24 215 38 HIS A 5 ? ? -95.68 46.73 216 38 SER A 7 ? ? -44.61 155.69 217 38 LEU A 9 ? ? -39.27 112.28 218 38 PRO A 18 ? ? -75.13 -84.81 219 38 ALA A 19 ? ? -84.34 48.82 220 38 CYS A 22 ? ? -59.03 88.38 221 38 ALA A 29 ? ? -155.66 -52.13 222 39 HIS A 5 ? ? -97.38 45.89 223 39 SER A 7 ? ? -38.45 157.07 224 39 ALA A 19 ? ? -92.82 30.00 225 39 CYS A 22 ? ? -58.31 86.94 226 39 CYS A 24 ? ? -127.07 -149.78 227 39 ARG A 25 ? ? -163.62 -64.32 228 39 PHE A 26 ? ? -83.09 -155.14 229 39 ALA A 29 ? ? -156.13 -75.17 230 40 HIS A 5 ? ? -84.28 46.50 231 40 ALA A 19 ? ? -95.71 38.50 232 40 CYS A 22 ? ? -53.95 88.19 233 40 CYS A 24 ? ? -122.34 -152.36 234 40 ARG A 25 ? ? -162.51 -63.37 235 40 PHE A 26 ? ? -83.51 -154.69 236 40 ALA A 29 ? ? -156.07 -76.01 # _pdbx_nmr_ensemble.entry_id 1MR0 _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 40 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1MR0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1.7 MM AGRP(87-120 NATURAL ABUNDANCE OF ALL NUCLEI.' 'pH 5.0 20 mM PERDEUTERATED ACETIC ACID' 2 '1.6 MM AGRP(87-120; C105A), NATURAL ABUNDANCE OF ALL NUCLEI.' 'pH 4.0 200 mM PERDEUTERATED ACETIC ACID' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 288 1 5.0 '20 mM PERDEUTERATED ACETIC ACID' atm K 2 288 1 4.0 '200 mM PERDEUTERATED ACETIC ACID' atm K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 2D-NOESY 1 2 1 DQF-COSY 1 3 1 TOCSY 1 4 2 'TOCSY(HX)' 2 # _pdbx_nmr_details.entry_id 1MR0 _pdbx_nmr_details.text 'THE NOESY, TOCSY AND DQF-COSY EXPERIMENTS WERE PERFORMED AT 800 MHZ; THE HX STUDY WAS CONDUCTED AT 500 MHZ.' # _pdbx_nmr_refine.entry_id 1MR0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE CALCULATIONS WERE ASSISTED WITH AUTOMATED ASSIGNMENT. FINAL STRUCTURES WERE CALCULATED USING 602 NOE-BASED UPPER LIMIT RESTRAINTS AND 23 ALPHA-TO- AMIDE 3-BOND J-COUPLING CONSTANTS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1B 'Krish Krishamurthy, Evan Williams, Steve Cheathum, Frtis Vosman, Dan Iverson, Michael Carlisle, Dan Steele, James Welch' 1 processing MNMR 940501 'Department of Chemistry,Carlsberg Laboratory, Copenhagen, Denmark' 2 'structure solution' DYANA 1.5 'Guntert, P., Mumenthaler, C., and Wuthrich, K.' 3 'data analysis' XEASY 1.2 'Bartels, C., Xia, T. H., Billeter, M., Guntert, P., and Wuthrich, K.' 4 refinement DYANA 1.5 'Guntert, P., Mumenthaler, C., and Wuthrich, K.' 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 LEU N N N N 158 LEU CA C N S 159 LEU C C N N 160 LEU O O N N 161 LEU CB C N N 162 LEU CG C N N 163 LEU CD1 C N N 164 LEU CD2 C N N 165 LEU OXT O N N 166 LEU H H N N 167 LEU H2 H N N 168 LEU HA H N N 169 LEU HB2 H N N 170 LEU HB3 H N N 171 LEU HG H N N 172 LEU HD11 H N N 173 LEU HD12 H N N 174 LEU HD13 H N N 175 LEU HD21 H N N 176 LEU HD22 H N N 177 LEU HD23 H N N 178 LEU HXT H N N 179 PHE N N N N 180 PHE CA C N S 181 PHE C C N N 182 PHE O O N N 183 PHE CB C N N 184 PHE CG C Y N 185 PHE CD1 C Y N 186 PHE CD2 C Y N 187 PHE CE1 C Y N 188 PHE CE2 C Y N 189 PHE CZ C Y N 190 PHE OXT O N N 191 PHE H H N N 192 PHE H2 H N N 193 PHE HA H N N 194 PHE HB2 H N N 195 PHE HB3 H N N 196 PHE HD1 H N N 197 PHE HD2 H N N 198 PHE HE1 H N N 199 PHE HE2 H N N 200 PHE HZ H N N 201 PHE HXT H N N 202 PRO N N N N 203 PRO CA C N S 204 PRO C C N N 205 PRO O O N N 206 PRO CB C N N 207 PRO CG C N N 208 PRO CD C N N 209 PRO OXT O N N 210 PRO H H N N 211 PRO HA H N N 212 PRO HB2 H N N 213 PRO HB3 H N N 214 PRO HG2 H N N 215 PRO HG3 H N N 216 PRO HD2 H N N 217 PRO HD3 H N N 218 PRO HXT H N N 219 SER N N N N 220 SER CA C N S 221 SER C C N N 222 SER O O N N 223 SER CB C N N 224 SER OG O N N 225 SER OXT O N N 226 SER H H N N 227 SER H2 H N N 228 SER HA H N N 229 SER HB2 H N N 230 SER HB3 H N N 231 SER HG H N N 232 SER HXT H N N 233 THR N N N N 234 THR CA C N S 235 THR C C N N 236 THR O O N N 237 THR CB C N R 238 THR OG1 O N N 239 THR CG2 C N N 240 THR OXT O N N 241 THR H H N N 242 THR H2 H N N 243 THR HA H N N 244 THR HB H N N 245 THR HG1 H N N 246 THR HG21 H N N 247 THR HG22 H N N 248 THR HG23 H N N 249 THR HXT H N N 250 TYR N N N N 251 TYR CA C N S 252 TYR C C N N 253 TYR O O N N 254 TYR CB C N N 255 TYR CG C Y N 256 TYR CD1 C Y N 257 TYR CD2 C Y N 258 TYR CE1 C Y N 259 TYR CE2 C Y N 260 TYR CZ C Y N 261 TYR OH O N N 262 TYR OXT O N N 263 TYR H H N N 264 TYR H2 H N N 265 TYR HA H N N 266 TYR HB2 H N N 267 TYR HB3 H N N 268 TYR HD1 H N N 269 TYR HD2 H N N 270 TYR HE1 H N N 271 TYR HE2 H N N 272 TYR HH H N N 273 TYR HXT H N N 274 VAL N N N N 275 VAL CA C N S 276 VAL C C N N 277 VAL O O N N 278 VAL CB C N N 279 VAL CG1 C N N 280 VAL CG2 C N N 281 VAL OXT O N N 282 VAL H H N N 283 VAL H2 H N N 284 VAL HA H N N 285 VAL HB H N N 286 VAL HG11 H N N 287 VAL HG12 H N N 288 VAL HG13 H N N 289 VAL HG21 H N N 290 VAL HG22 H N N 291 VAL HG23 H N N 292 VAL HXT H N N 293 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 PHE N CA sing N N 171 PHE N H sing N N 172 PHE N H2 sing N N 173 PHE CA C sing N N 174 PHE CA CB sing N N 175 PHE CA HA sing N N 176 PHE C O doub N N 177 PHE C OXT sing N N 178 PHE CB CG sing N N 179 PHE CB HB2 sing N N 180 PHE CB HB3 sing N N 181 PHE CG CD1 doub Y N 182 PHE CG CD2 sing Y N 183 PHE CD1 CE1 sing Y N 184 PHE CD1 HD1 sing N N 185 PHE CD2 CE2 doub Y N 186 PHE CD2 HD2 sing N N 187 PHE CE1 CZ doub Y N 188 PHE CE1 HE1 sing N N 189 PHE CE2 CZ sing Y N 190 PHE CE2 HE2 sing N N 191 PHE CZ HZ sing N N 192 PHE OXT HXT sing N N 193 PRO N CA sing N N 194 PRO N CD sing N N 195 PRO N H sing N N 196 PRO CA C sing N N 197 PRO CA CB sing N N 198 PRO CA HA sing N N 199 PRO C O doub N N 200 PRO C OXT sing N N 201 PRO CB CG sing N N 202 PRO CB HB2 sing N N 203 PRO CB HB3 sing N N 204 PRO CG CD sing N N 205 PRO CG HG2 sing N N 206 PRO CG HG3 sing N N 207 PRO CD HD2 sing N N 208 PRO CD HD3 sing N N 209 PRO OXT HXT sing N N 210 SER N CA sing N N 211 SER N H sing N N 212 SER N H2 sing N N 213 SER CA C sing N N 214 SER CA CB sing N N 215 SER CA HA sing N N 216 SER C O doub N N 217 SER C OXT sing N N 218 SER CB OG sing N N 219 SER CB HB2 sing N N 220 SER CB HB3 sing N N 221 SER OG HG sing N N 222 SER OXT HXT sing N N 223 THR N CA sing N N 224 THR N H sing N N 225 THR N H2 sing N N 226 THR CA C sing N N 227 THR CA CB sing N N 228 THR CA HA sing N N 229 THR C O doub N N 230 THR C OXT sing N N 231 THR CB OG1 sing N N 232 THR CB CG2 sing N N 233 THR CB HB sing N N 234 THR OG1 HG1 sing N N 235 THR CG2 HG21 sing N N 236 THR CG2 HG22 sing N N 237 THR CG2 HG23 sing N N 238 THR OXT HXT sing N N 239 TYR N CA sing N N 240 TYR N H sing N N 241 TYR N H2 sing N N 242 TYR CA C sing N N 243 TYR CA CB sing N N 244 TYR CA HA sing N N 245 TYR C O doub N N 246 TYR C OXT sing N N 247 TYR CB CG sing N N 248 TYR CB HB2 sing N N 249 TYR CB HB3 sing N N 250 TYR CG CD1 doub Y N 251 TYR CG CD2 sing Y N 252 TYR CD1 CE1 sing Y N 253 TYR CD1 HD1 sing N N 254 TYR CD2 CE2 doub Y N 255 TYR CD2 HD2 sing N N 256 TYR CE1 CZ doub Y N 257 TYR CE1 HE1 sing N N 258 TYR CE2 CZ sing Y N 259 TYR CE2 HE2 sing N N 260 TYR CZ OH sing N N 261 TYR OH HH sing N N 262 TYR OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 UNITYPLUS Varian 800 ? 2 UNITYPLUS Varian 500 ? # _atom_sites.entry_id 1MR0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_