data_1N4I # _entry.id 1N4I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1N4I pdb_00001n4i 10.2210/pdb1n4i/pdb RCSB RCSB017508 ? ? WWPDB D_1000017508 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 5573 'Chemical shift data' unspecified PDB 1EWW 'Structure of sbwAFP at 30C' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1N4I _pdbx_database_status.recvd_initial_deposition_date 2002-10-31 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Graether, S.P.' 1 'Gagne, S.M.' 2 'Spyracopoulos, L.' 3 'Jia, Z.' 4 'Davies, P.L.' 5 'Sykes, B.D.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Spruce Budworm Antifreeze Protein: Changes in Structure and Dynamics at Low Temperature' J.Mol.Biol. 327 1155 1168 2003 JMOBAK UK 0022-2836 0070 ? 12662938 '10.1016/S0022-2836(03)00235-3' 1 'Beta-helix structure and ice-binding properties of a hyperactive antifreeze protein from an insect' Nature 406 325 328 2000 NATUAS UK 0028-0836 0006 ? ? 10.1038/35018610 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Graether, S.P.' 1 ? primary 'Gagne, S.M.' 2 ? primary 'Spyracopoulos, L.' 3 ? primary 'Jia, Z.' 4 ? primary 'Davies, P.L.' 5 ? primary 'Sykes, B.D.' 6 ? 1 'Graether, S.P.' 7 ? 1 'Kuiper, M.J.' 8 ? 1 'Gagne, S.M.' 9 ? 1 'Walkver, V.K.' 10 ? 1 'Jia, Z.' 11 ? 1 'Sykes, B.D.' 12 ? 1 'Davies, P.L.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'thermal hysteresis protein' _entity.formula_weight 9068.034 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAAC KISGCTFSAN ; _entity_poly.pdbx_seq_one_letter_code_can ;DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAAC KISGCTFSAN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 GLY n 1 3 SER n 1 4 CYS n 1 5 THR n 1 6 ASN n 1 7 THR n 1 8 ASN n 1 9 SER n 1 10 GLN n 1 11 LEU n 1 12 SER n 1 13 ALA n 1 14 ASN n 1 15 SER n 1 16 LYS n 1 17 CYS n 1 18 GLU n 1 19 LYS n 1 20 SER n 1 21 THR n 1 22 LEU n 1 23 THR n 1 24 ASN n 1 25 CYS n 1 26 TYR n 1 27 VAL n 1 28 ASP n 1 29 LYS n 1 30 SER n 1 31 GLU n 1 32 VAL n 1 33 TYR n 1 34 GLY n 1 35 THR n 1 36 THR n 1 37 CYS n 1 38 THR n 1 39 GLY n 1 40 SER n 1 41 ARG n 1 42 PHE n 1 43 ASP n 1 44 GLY n 1 45 VAL n 1 46 THR n 1 47 ILE n 1 48 THR n 1 49 THR n 1 50 SER n 1 51 THR n 1 52 SER n 1 53 THR n 1 54 GLY n 1 55 SER n 1 56 ARG n 1 57 ILE n 1 58 SER n 1 59 GLY n 1 60 PRO n 1 61 GLY n 1 62 CYS n 1 63 LYS n 1 64 ILE n 1 65 SER n 1 66 THR n 1 67 CYS n 1 68 ILE n 1 69 ILE n 1 70 THR n 1 71 GLY n 1 72 GLY n 1 73 VAL n 1 74 PRO n 1 75 ALA n 1 76 PRO n 1 77 SER n 1 78 ALA n 1 79 ALA n 1 80 CYS n 1 81 LYS n 1 82 ILE n 1 83 SER n 1 84 GLY n 1 85 CYS n 1 86 THR n 1 87 PHE n 1 88 SER n 1 89 ALA n 1 90 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'spruce budworm' _entity_src_gen.gene_src_genus Choristoneura _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Choristoneura fumiferana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7141 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9GTP0_CHOFU _struct_ref.pdbx_db_accession Q9GTP0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DGSCTNTNSQLSANSKCEKSTLTNCYVDKSEVYGTTCTGSRFDGVTITTSTSTGSRISGPGCKISTCIITGGVPAPSAAC KISGCTFSAN ; _struct_ref.pdbx_align_begin 19 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1N4I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 90 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9GTP0 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 90 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C/15N-separated_NOESY 3 1 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 278 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'Uniform lableing with 13C, 15N' _pdbx_nmr_sample_details.solvent_system '90% H2O, 10% D20' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian UNITY 800 2 ? Varian INOVA 500 3 ? Varian INOVA 600 # _pdbx_nmr_refine.entry_id 1N4I _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1N4I _pdbx_nmr_details.text 'This structure was determined using standard 3D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 1N4I _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1N4I _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal X-PLOR 3.851 refinement Brunger 1 NMRPipe 97.231.15.18 processing Delaglio 2 PIPP 1997 'data analysis' Garrett 3 VNMR 6.1C collection Varian 4 # _exptl.entry_id 1N4I _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1N4I _struct.title 'Solution structure of spruce budworm antifreeze protein at 5 degrees celsius' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1N4I _struct_keywords.pdbx_keywords 'ANTIFREEZE PROTEIN' _struct_keywords.text 'BETA-HELIX, ANTIFREEZE PROTEIN, ICE, INSECT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 4 A CYS 17 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 25 A CYS 37 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 62 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 62 A CYS 85 1_555 ? ? ? ? ? ? ? 2.024 ? ? disulf4 disulf ? ? A CYS 67 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 67 A CYS 80 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? parallel C 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 15 ? GLU A 18 ? SER A 15 GLU A 18 A 2 SER A 30 ? TYR A 33 ? SER A 30 TYR A 33 A 3 VAL A 45 ? THR A 48 ? VAL A 45 THR A 48 A 4 CYS A 62 ? SER A 65 ? CYS A 62 SER A 65 B 1 SER A 20 ? THR A 23 ? SER A 20 THR A 23 B 2 THR A 35 ? THR A 38 ? THR A 35 THR A 38 B 3 SER A 50 ? THR A 53 ? SER A 50 THR A 53 B 4 CYS A 62 ? SER A 65 ? CYS A 62 SER A 65 C 1 CYS A 25 ? ASP A 28 ? CYS A 25 ASP A 28 C 2 SER A 40 ? ASP A 43 ? SER A 40 ASP A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 15 ? N SER A 15 O SER A 30 ? O SER A 30 A 2 3 N SER A 30 ? N SER A 30 O VAL A 45 ? O VAL A 45 A 3 4 N VAL A 45 ? N VAL A 45 O CYS A 62 ? O CYS A 62 B 1 2 N SER A 20 ? N SER A 20 O THR A 35 ? O THR A 35 B 2 3 N THR A 35 ? N THR A 35 O SER A 50 ? O SER A 50 B 3 4 N SER A 50 ? N SER A 50 O CYS A 62 ? O CYS A 62 C 1 2 N SER A 40 ? N SER A 40 O CYS A 25 ? O CYS A 25 # _database_PDB_matrix.entry_id 1N4I _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1N4I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 1 1 ASP ASP A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 CYS 80 80 80 CYS CYS A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASN 90 90 90 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-04-08 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A THR 51 ? ? H A ILE 69 ? ? 1.49 2 2 O A SER 12 ? ? H A SER 15 ? ? 1.58 3 3 H A ASN 24 ? ? O A CYS 37 ? ? 1.56 4 4 O A LYS 63 ? ? HZ1 A LYS 81 ? ? 1.40 5 4 HG A SER 50 ? ? O A CYS 67 ? ? 1.53 6 5 O A THR 5 ? ? H A ASN 8 ? ? 1.53 7 5 H A SER 12 ? ? O A VAL 27 ? ? 1.53 8 6 O A THR 5 ? ? H A ASN 8 ? ? 1.46 9 6 H A THR 70 ? ? O A VAL 73 ? ? 1.56 10 7 O A ILE 68 ? ? H A ALA 75 ? ? 1.53 11 7 O A THR 5 ? ? H A THR 7 ? ? 1.53 12 7 O A THR 53 ? ? H A GLY 71 ? ? 1.54 13 8 O A ASN 6 ? ? H A ASN 8 ? ? 1.51 14 8 O A SER 12 ? ? H A SER 15 ? ? 1.52 15 8 HG1 A THR 35 ? ? O A THR 48 ? ? 1.53 16 9 O A ASN 6 ? ? H A ASN 8 ? ? 1.52 17 9 H A GLY 34 ? ? O A THR 48 ? ? 1.52 18 9 H A SER 12 ? ? O A VAL 27 ? ? 1.60 19 10 O A THR 5 ? ? H A THR 7 ? ? 1.53 20 10 O A THR 53 ? ? H A GLY 71 ? ? 1.55 21 11 OG1 A THR 48 ? ? H A THR 66 ? ? 1.60 22 12 O A THR 53 ? ? H A GLY 71 ? ? 1.56 23 12 O A THR 5 ? ? H A SER 9 ? ? 1.57 24 12 H A ARG 56 ? ? O A PHE 87 ? ? 1.58 25 12 O A THR 51 ? ? H A ILE 69 ? ? 1.60 26 13 O A THR 48 ? ? H A THR 66 ? ? 1.53 27 14 O A THR 51 ? ? H A ILE 69 ? ? 1.60 28 15 H A SER 12 ? ? O A VAL 27 ? ? 1.55 29 16 O A THR 5 ? ? H A ASN 8 ? ? 1.49 30 16 O A LEU 11 ? ? H A ALA 13 ? ? 1.55 31 16 O A ASN 6 ? ? H A ASN 24 ? ? 1.57 32 17 O A THR 5 ? ? HD21 A ASN 6 ? ? 1.47 33 17 O A ASN 6 ? ? H A ASN 24 ? ? 1.48 34 17 O A THR 5 ? ? H A ASN 8 ? ? 1.50 35 17 H A SER 12 ? ? O A VAL 27 ? ? 1.58 36 17 O A THR 5 ? ? H A SER 9 ? ? 1.58 37 19 HG A SER 9 ? ? O A CYS 25 ? ? 1.50 38 19 O A THR 53 ? ? H A GLY 71 ? ? 1.58 39 20 HG1 A THR 35 ? ? O A THR 48 ? ? 1.57 40 20 HD22 A ASN 14 ? ? O A ASP 28 ? ? 1.59 41 21 O A THR 5 ? ? H A THR 7 ? ? 1.54 42 21 O A THR 51 ? ? H A ILE 69 ? ? 1.56 43 22 O A THR 5 ? ? H A THR 7 ? ? 1.53 44 22 HH11 A ARG 41 ? ? OXT A ASN 90 ? ? 1.55 45 23 O A THR 53 ? ? H A GLY 71 ? ? 1.55 46 24 O A THR 51 ? ? H A ILE 69 ? ? 1.51 47 24 HD22 A ASN 6 ? ? OG A SER 9 ? ? 1.59 48 24 O A THR 5 ? ? H A SER 9 ? ? 1.60 49 25 HZ3 A LYS 16 ? ? OH A TYR 33 ? ? 1.45 50 25 O A THR 51 ? ? H A ILE 69 ? ? 1.54 51 25 O A SER 12 ? ? H A SER 15 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 3 ? ? 46.99 -158.89 2 1 CYS A 4 ? ? 65.22 142.97 3 1 THR A 5 ? ? -167.62 84.26 4 1 ASN A 6 ? ? -62.35 72.48 5 1 ASN A 8 ? ? 175.02 -31.27 6 1 SER A 9 ? ? 73.80 111.59 7 1 ALA A 13 ? ? 179.93 -32.89 8 1 SER A 15 ? ? -68.26 -171.52 9 1 GLU A 18 ? ? -126.04 -51.71 10 1 LYS A 19 ? ? -162.02 55.50 11 1 THR A 23 ? ? -164.25 119.09 12 1 CYS A 25 ? ? -105.95 -155.54 13 1 TYR A 26 ? ? -167.51 -40.78 14 1 VAL A 27 ? ? 54.63 149.72 15 1 GLU A 31 ? ? -128.20 -67.09 16 1 VAL A 32 ? ? 62.64 154.01 17 1 TYR A 33 ? ? -150.08 -43.04 18 1 THR A 36 ? ? -109.13 55.83 19 1 ASP A 43 ? ? -169.43 65.86 20 1 THR A 46 ? ? -153.21 55.48 21 1 THR A 48 ? ? -146.24 -136.40 22 1 THR A 49 ? ? -58.33 82.23 23 1 SER A 58 ? ? -42.68 153.64 24 1 THR A 66 ? ? 68.17 80.12 25 1 PRO A 76 ? ? -68.97 66.16 26 1 ILE A 82 ? ? 47.13 74.38 27 1 SER A 83 ? ? -127.59 -80.98 28 1 SER A 88 ? ? -141.36 22.87 29 1 ALA A 89 ? ? 55.71 80.32 30 2 SER A 3 ? ? -115.33 -81.05 31 2 CYS A 4 ? ? 59.32 174.63 32 2 THR A 5 ? ? -161.87 17.24 33 2 ASN A 6 ? ? 32.16 59.11 34 2 THR A 7 ? ? 72.88 -54.42 35 2 ASN A 8 ? ? 170.50 88.33 36 2 SER A 9 ? ? -172.08 -86.31 37 2 GLN A 10 ? ? -173.08 103.51 38 2 SER A 12 ? ? -36.34 134.60 39 2 SER A 15 ? ? -73.08 -169.15 40 2 GLU A 18 ? ? 169.65 -80.20 41 2 SER A 20 ? ? -77.00 -147.42 42 2 THR A 21 ? ? -153.23 88.58 43 2 ASN A 24 ? ? 37.05 40.91 44 2 CYS A 25 ? ? -81.69 -152.38 45 2 TYR A 26 ? ? 179.46 42.72 46 2 LYS A 29 ? ? -168.86 68.48 47 2 PHE A 42 ? ? -119.15 -168.99 48 2 ASP A 43 ? ? -179.91 61.88 49 2 VAL A 45 ? ? -138.59 -157.69 50 2 THR A 46 ? ? -167.75 57.28 51 2 THR A 48 ? ? -131.96 -134.34 52 2 THR A 49 ? ? -65.89 64.97 53 2 SER A 58 ? ? -42.56 150.16 54 2 THR A 66 ? ? 39.77 85.58 55 2 ALA A 79 ? ? -132.28 -32.34 56 2 ILE A 82 ? ? -155.99 38.98 57 2 SER A 83 ? ? -59.71 -104.40 58 2 CYS A 85 ? ? -147.18 -149.39 59 2 THR A 86 ? ? 169.98 142.96 60 2 SER A 88 ? ? 45.72 -92.02 61 2 ALA A 89 ? ? 157.36 64.92 62 3 CYS A 4 ? ? -166.54 -109.43 63 3 THR A 5 ? ? -157.41 -3.90 64 3 SER A 9 ? ? -86.04 -125.98 65 3 GLN A 10 ? ? -131.39 -71.73 66 3 LEU A 11 ? ? 57.03 111.57 67 3 SER A 15 ? ? -76.27 -163.29 68 3 LYS A 19 ? ? 43.01 90.01 69 3 THR A 21 ? ? -156.55 72.78 70 3 LEU A 22 ? ? -75.44 -116.66 71 3 THR A 23 ? ? 146.21 -62.59 72 3 CYS A 25 ? ? -67.85 -159.64 73 3 TYR A 26 ? ? -162.96 -54.74 74 3 VAL A 27 ? ? 44.59 -179.00 75 3 ASP A 28 ? ? -175.81 -33.84 76 3 LYS A 29 ? ? -150.45 56.30 77 3 TYR A 33 ? ? -157.33 44.66 78 3 THR A 36 ? ? -94.61 53.35 79 3 CYS A 37 ? ? -50.40 87.51 80 3 PHE A 42 ? ? -116.64 -167.63 81 3 ASP A 43 ? ? -177.46 53.56 82 3 THR A 46 ? ? -149.47 51.02 83 3 THR A 48 ? ? -142.73 -98.76 84 3 THR A 49 ? ? -104.05 69.83 85 3 SER A 58 ? ? -43.80 151.03 86 3 THR A 66 ? ? 39.02 71.59 87 3 ILE A 82 ? ? 38.19 57.75 88 3 SER A 83 ? ? -113.37 -100.42 89 3 ALA A 89 ? ? 47.14 95.98 90 4 SER A 3 ? ? -162.93 47.12 91 4 THR A 7 ? ? 69.39 70.14 92 4 ASN A 8 ? ? 67.45 93.16 93 4 SER A 9 ? ? -167.65 -139.20 94 4 LEU A 11 ? ? 41.19 84.77 95 4 SER A 12 ? ? -45.46 164.98 96 4 GLU A 18 ? ? -172.86 -87.89 97 4 LYS A 19 ? ? -114.55 72.10 98 4 SER A 20 ? ? -117.92 -164.39 99 4 THR A 21 ? ? -150.15 60.42 100 4 THR A 23 ? ? -164.78 101.63 101 4 ASN A 24 ? ? 59.18 118.94 102 4 CYS A 25 ? ? -171.00 -151.68 103 4 TYR A 26 ? ? -157.68 -42.02 104 4 VAL A 27 ? ? 39.22 101.20 105 4 ASP A 28 ? ? -88.71 -130.59 106 4 LYS A 29 ? ? -62.36 81.91 107 4 TYR A 33 ? ? -135.06 -71.75 108 4 CYS A 37 ? ? 35.67 63.34 109 4 THR A 38 ? ? -65.57 78.57 110 4 SER A 40 ? ? -107.09 -138.67 111 4 ARG A 41 ? ? 175.96 154.58 112 4 ASP A 43 ? ? -159.60 73.49 113 4 THR A 46 ? ? -159.92 58.55 114 4 THR A 48 ? ? -137.18 -92.07 115 4 THR A 49 ? ? -111.97 65.96 116 4 SER A 52 ? ? -38.12 128.02 117 4 THR A 66 ? ? 37.76 53.64 118 4 ILE A 69 ? ? 56.74 157.98 119 4 THR A 70 ? ? -169.66 107.51 120 4 ALA A 79 ? ? -160.45 -37.40 121 4 CYS A 80 ? ? -39.46 158.31 122 4 LYS A 81 ? ? -100.56 -167.91 123 4 ILE A 82 ? ? 177.51 31.82 124 4 SER A 83 ? ? -70.71 -101.05 125 4 CYS A 85 ? ? -161.70 -159.64 126 4 THR A 86 ? ? 169.10 150.36 127 4 ALA A 89 ? ? 65.17 66.94 128 5 SER A 3 ? ? -101.17 -101.39 129 5 CYS A 4 ? ? 58.78 -80.04 130 5 THR A 5 ? ? 58.23 15.96 131 5 THR A 7 ? ? 77.61 -3.16 132 5 ASN A 8 ? ? 162.68 86.78 133 5 SER A 9 ? ? -177.11 -149.94 134 5 LEU A 11 ? ? 46.34 86.66 135 5 SER A 15 ? ? -79.42 -163.70 136 5 CYS A 17 ? ? 174.69 47.75 137 5 LYS A 19 ? ? -161.68 77.07 138 5 SER A 20 ? ? -115.31 -153.24 139 5 THR A 21 ? ? -155.62 77.09 140 5 THR A 23 ? ? -155.02 -47.97 141 5 ASN A 24 ? ? -144.25 23.51 142 5 CYS A 25 ? ? -58.16 -152.65 143 5 TYR A 26 ? ? -160.59 -52.85 144 5 VAL A 27 ? ? 49.39 117.55 145 5 LYS A 29 ? ? -167.40 84.02 146 5 TYR A 33 ? ? -150.18 -42.86 147 5 THR A 36 ? ? -95.95 54.49 148 5 CYS A 37 ? ? -38.31 98.08 149 5 THR A 38 ? ? -104.38 69.62 150 5 ASP A 43 ? ? -155.86 42.98 151 5 THR A 46 ? ? -155.38 58.82 152 5 THR A 48 ? ? -142.61 -138.05 153 5 THR A 49 ? ? -58.24 83.81 154 5 SER A 55 ? ? -175.42 102.82 155 5 SER A 58 ? ? -36.99 151.33 156 5 CYS A 62 ? ? -41.58 161.37 157 5 THR A 66 ? ? 63.00 73.25 158 5 THR A 70 ? ? -162.63 100.93 159 5 ILE A 82 ? ? 25.11 51.88 160 5 SER A 83 ? ? -117.76 -141.75 161 5 SER A 88 ? ? -142.21 12.58 162 6 ASN A 6 ? ? 35.76 50.80 163 6 ASN A 8 ? ? -171.06 -48.87 164 6 SER A 9 ? ? 92.71 86.23 165 6 SER A 12 ? ? -37.73 158.33 166 6 SER A 15 ? ? -84.67 -159.56 167 6 CYS A 17 ? ? -164.63 56.68 168 6 CYS A 25 ? ? -109.47 -169.12 169 6 TYR A 26 ? ? -173.26 34.68 170 6 VAL A 27 ? ? -33.16 142.16 171 6 VAL A 32 ? ? 62.05 150.21 172 6 TYR A 33 ? ? -142.35 -47.43 173 6 CYS A 37 ? ? 48.86 76.76 174 6 ASP A 43 ? ? -178.35 63.01 175 6 VAL A 45 ? ? -137.37 -159.53 176 6 THR A 46 ? ? -166.89 57.81 177 6 THR A 48 ? ? -135.51 -134.03 178 6 THR A 49 ? ? -66.12 89.90 179 6 SER A 52 ? ? -37.18 122.01 180 6 SER A 58 ? ? -42.71 162.97 181 6 CYS A 62 ? ? -38.96 126.57 182 6 ILE A 69 ? ? 54.88 162.92 183 6 THR A 70 ? ? -146.33 -121.78 184 6 CYS A 80 ? ? -46.36 166.30 185 6 SER A 83 ? ? -109.33 -73.19 186 6 CYS A 85 ? ? -134.53 -153.00 187 6 THR A 86 ? ? 176.91 143.21 188 6 SER A 88 ? ? -140.95 12.17 189 7 SER A 3 ? ? 49.21 95.91 190 7 THR A 5 ? ? -154.10 25.89 191 7 ASN A 6 ? ? 65.85 -61.84 192 7 THR A 7 ? ? -161.86 -38.56 193 7 ASN A 8 ? ? 177.21 32.94 194 7 SER A 9 ? ? -111.78 -107.07 195 7 GLN A 10 ? ? -140.39 -43.56 196 7 LEU A 11 ? ? 47.68 81.77 197 7 SER A 15 ? ? -80.42 -157.61 198 7 GLU A 18 ? ? -168.80 -129.36 199 7 CYS A 25 ? ? -78.83 -154.34 200 7 TYR A 26 ? ? 176.26 40.60 201 7 SER A 30 ? ? -124.47 -161.13 202 7 GLU A 31 ? ? -138.20 -63.13 203 7 VAL A 32 ? ? 61.16 156.64 204 7 TYR A 33 ? ? -153.95 -39.11 205 7 THR A 36 ? ? -111.52 50.23 206 7 SER A 40 ? ? -115.52 -159.29 207 7 ASP A 43 ? ? -160.54 42.90 208 7 THR A 46 ? ? -152.89 58.20 209 7 THR A 48 ? ? -146.09 -139.70 210 7 THR A 49 ? ? -52.94 91.48 211 7 THR A 66 ? ? 51.21 71.14 212 7 SER A 83 ? ? -114.95 -130.11 213 7 SER A 88 ? ? -144.91 24.91 214 7 ALA A 89 ? ? 52.84 85.88 215 8 CYS A 4 ? ? 56.67 -147.38 216 8 THR A 5 ? ? 178.91 -29.70 217 8 THR A 7 ? ? 63.66 -63.81 218 8 ASN A 8 ? ? -73.16 -88.55 219 8 SER A 9 ? ? 152.93 58.40 220 8 GLN A 10 ? ? -140.69 16.56 221 8 LEU A 11 ? ? -62.96 81.89 222 8 SER A 12 ? ? -30.62 134.16 223 8 LYS A 19 ? ? 52.83 108.58 224 8 SER A 20 ? ? 178.69 146.69 225 8 TYR A 26 ? ? -147.00 34.33 226 8 VAL A 27 ? ? -30.52 147.69 227 8 VAL A 32 ? ? 67.15 143.14 228 8 TYR A 33 ? ? -137.62 -52.71 229 8 THR A 36 ? ? -111.95 58.24 230 8 CYS A 37 ? ? -36.87 137.77 231 8 ASP A 43 ? ? -170.09 50.91 232 8 THR A 46 ? ? -160.73 53.25 233 8 THR A 48 ? ? -138.21 -139.71 234 8 THR A 49 ? ? -58.33 80.53 235 8 SER A 58 ? ? -36.02 142.77 236 8 LYS A 63 ? ? -161.08 98.71 237 8 THR A 66 ? ? -33.36 85.64 238 8 THR A 70 ? ? -162.01 98.82 239 8 ILE A 82 ? ? -161.59 75.12 240 8 SER A 83 ? ? -112.08 -86.55 241 8 THR A 86 ? ? 179.81 158.87 242 8 ALA A 89 ? ? 37.87 72.01 243 9 CYS A 4 ? ? -52.80 173.73 244 9 THR A 7 ? ? 63.80 -56.15 245 9 ASN A 8 ? ? 177.11 64.26 246 9 SER A 9 ? ? -131.20 -121.98 247 9 GLN A 10 ? ? -131.08 -41.55 248 9 LEU A 11 ? ? 43.46 96.54 249 9 SER A 12 ? ? -37.91 150.11 250 9 SER A 15 ? ? -69.21 -154.57 251 9 CYS A 17 ? ? -135.99 -92.18 252 9 GLU A 18 ? ? 38.05 -125.68 253 9 SER A 20 ? ? 175.94 172.68 254 9 THR A 21 ? ? -154.04 76.41 255 9 CYS A 25 ? ? -64.31 -141.85 256 9 TYR A 26 ? ? 166.34 45.82 257 9 LYS A 29 ? ? 179.99 67.64 258 9 TYR A 33 ? ? -149.16 -32.00 259 9 CYS A 37 ? ? -47.04 97.86 260 9 THR A 38 ? ? -85.91 31.88 261 9 ASP A 43 ? ? -174.22 55.67 262 9 THR A 46 ? ? -151.89 60.01 263 9 THR A 48 ? ? -139.77 -89.82 264 9 THR A 49 ? ? -114.30 74.35 265 9 SER A 58 ? ? -47.15 161.93 266 9 THR A 66 ? ? 50.33 71.86 267 9 ILE A 69 ? ? 63.42 155.96 268 9 THR A 70 ? ? -147.73 -115.92 269 9 SER A 77 ? ? -165.93 24.36 270 9 ALA A 78 ? ? 44.51 27.39 271 9 ALA A 79 ? ? -157.44 -34.43 272 9 ILE A 82 ? ? -154.59 60.95 273 9 SER A 83 ? ? -98.35 -116.94 274 9 THR A 86 ? ? -175.83 145.88 275 9 ALA A 89 ? ? 48.13 91.99 276 10 ASN A 6 ? ? 67.31 -59.31 277 10 THR A 7 ? ? -162.17 -37.80 278 10 ASN A 8 ? ? 176.59 42.21 279 10 SER A 9 ? ? -129.20 -74.92 280 10 GLN A 10 ? ? -161.58 -57.75 281 10 LEU A 11 ? ? 52.61 89.78 282 10 SER A 15 ? ? -66.78 -174.59 283 10 GLU A 18 ? ? -175.43 125.10 284 10 THR A 23 ? ? -164.13 118.86 285 10 ASN A 24 ? ? 50.43 101.58 286 10 TYR A 26 ? ? -164.29 34.65 287 10 VAL A 27 ? ? -33.05 151.71 288 10 LYS A 29 ? ? 48.11 72.88 289 10 TYR A 33 ? ? -154.42 32.14 290 10 THR A 35 ? ? -38.66 162.26 291 10 CYS A 37 ? ? 38.59 95.30 292 10 SER A 40 ? ? -104.79 -166.09 293 10 ASP A 43 ? ? -165.95 46.93 294 10 THR A 46 ? ? -151.39 59.17 295 10 THR A 48 ? ? -139.36 -128.20 296 10 THR A 49 ? ? -65.96 73.28 297 10 SER A 58 ? ? -43.75 155.28 298 10 LYS A 63 ? ? -160.51 114.02 299 10 THR A 66 ? ? 51.97 77.82 300 10 ALA A 79 ? ? -151.35 -38.07 301 10 CYS A 80 ? ? -49.52 170.45 302 10 SER A 83 ? ? -125.38 -116.03 303 10 THR A 86 ? ? 176.62 170.04 304 11 SER A 3 ? ? 48.29 -140.24 305 11 CYS A 4 ? ? 71.59 145.08 306 11 ASN A 8 ? ? 178.17 -41.55 307 11 SER A 9 ? ? 78.80 85.35 308 11 LEU A 11 ? ? -47.74 91.28 309 11 SER A 12 ? ? -38.24 137.00 310 11 SER A 15 ? ? -89.03 -157.48 311 11 GLU A 18 ? ? 174.02 104.98 312 11 LEU A 22 ? ? 62.24 159.03 313 11 THR A 23 ? ? -174.61 117.66 314 11 TYR A 26 ? ? -155.13 -40.55 315 11 VAL A 27 ? ? 56.39 137.49 316 11 VAL A 32 ? ? 62.58 144.73 317 11 TYR A 33 ? ? -152.40 34.23 318 11 THR A 35 ? ? -40.34 151.02 319 11 CYS A 37 ? ? 52.21 83.68 320 11 ASP A 43 ? ? -168.14 41.10 321 11 VAL A 45 ? ? -129.03 -165.84 322 11 THR A 46 ? ? -163.44 57.90 323 11 THR A 48 ? ? -129.93 -156.32 324 11 THR A 49 ? ? -48.50 88.24 325 11 SER A 52 ? ? -39.06 114.45 326 11 THR A 66 ? ? 50.96 73.06 327 11 ILE A 68 ? ? -48.32 -75.18 328 11 ILE A 69 ? ? 62.81 140.34 329 11 THR A 70 ? ? -165.74 101.80 330 11 ILE A 82 ? ? 26.41 50.19 331 11 SER A 83 ? ? -108.21 -157.67 332 11 CYS A 85 ? ? -170.87 -168.43 333 11 ALA A 89 ? ? 57.15 119.22 334 12 THR A 5 ? ? 76.91 -13.78 335 12 ASN A 6 ? ? 35.82 40.61 336 12 THR A 7 ? ? 70.80 35.37 337 12 ASN A 8 ? ? 168.93 -42.32 338 12 SER A 9 ? ? 73.16 89.55 339 12 LEU A 11 ? ? -39.42 101.04 340 12 ALA A 13 ? ? 49.43 -157.06 341 12 ASN A 14 ? ? -90.49 57.58 342 12 SER A 15 ? ? -58.54 -168.26 343 12 GLU A 18 ? ? -176.30 -154.43 344 12 THR A 23 ? ? -161.13 118.83 345 12 VAL A 27 ? ? 47.24 112.88 346 12 ASP A 28 ? ? -98.13 -91.91 347 12 GLU A 31 ? ? -137.72 -66.40 348 12 VAL A 32 ? ? 69.99 150.58 349 12 TYR A 33 ? ? -138.68 -46.39 350 12 CYS A 37 ? ? -42.42 97.90 351 12 SER A 40 ? ? -126.54 -156.11 352 12 ASP A 43 ? ? 178.59 61.14 353 12 THR A 46 ? ? -160.85 54.81 354 12 THR A 48 ? ? -135.78 -127.63 355 12 THR A 49 ? ? -69.74 72.66 356 12 THR A 66 ? ? 53.29 86.54 357 12 ILE A 68 ? ? -67.60 96.67 358 12 THR A 70 ? ? -163.38 110.07 359 12 LYS A 81 ? ? -102.56 -168.98 360 12 ILE A 82 ? ? 179.03 33.87 361 12 SER A 83 ? ? -62.21 -92.59 362 12 CYS A 85 ? ? -144.82 -152.47 363 12 THR A 86 ? ? 172.90 148.44 364 12 SER A 88 ? ? 52.85 -90.57 365 12 ALA A 89 ? ? 157.41 74.28 366 13 SER A 3 ? ? -152.11 63.51 367 13 CYS A 4 ? ? -108.80 -117.34 368 13 THR A 5 ? ? -166.78 -36.79 369 13 ASN A 8 ? ? 70.20 83.58 370 13 SER A 9 ? ? -138.84 -95.34 371 13 GLN A 10 ? ? 173.28 -44.09 372 13 LEU A 11 ? ? 48.91 89.07 373 13 SER A 12 ? ? -44.48 156.11 374 13 SER A 15 ? ? -78.18 -158.71 375 13 LYS A 19 ? ? 52.41 104.00 376 13 SER A 20 ? ? -158.95 -158.72 377 13 THR A 21 ? ? -152.48 86.57 378 13 CYS A 25 ? ? -71.20 -145.65 379 13 TYR A 26 ? ? -179.34 -50.67 380 13 VAL A 27 ? ? 52.05 121.29 381 13 LYS A 29 ? ? -166.65 58.26 382 13 TYR A 33 ? ? -143.19 -36.60 383 13 THR A 36 ? ? -112.45 53.36 384 13 CYS A 37 ? ? -39.48 103.28 385 13 THR A 38 ? ? -103.56 79.37 386 13 SER A 40 ? ? -161.27 -148.03 387 13 ARG A 41 ? ? 172.79 158.72 388 13 ASP A 43 ? ? -173.65 57.60 389 13 THR A 46 ? ? -156.16 58.16 390 13 CYS A 62 ? ? -44.18 164.80 391 13 THR A 66 ? ? 44.55 71.49 392 13 PRO A 76 ? ? -68.70 64.41 393 13 ILE A 82 ? ? -15.01 82.48 394 13 SER A 83 ? ? -128.89 -70.21 395 13 CYS A 85 ? ? -177.05 -150.47 396 13 THR A 86 ? ? 174.00 161.87 397 13 ALA A 89 ? ? 55.65 112.37 398 14 CYS A 4 ? ? -161.58 -157.21 399 14 THR A 5 ? ? -171.23 35.15 400 14 ASN A 6 ? ? 55.94 -88.45 401 14 THR A 7 ? ? -142.50 -0.71 402 14 ASN A 8 ? ? 173.13 -19.52 403 14 SER A 9 ? ? -87.91 -115.90 404 14 LEU A 11 ? ? 59.82 106.88 405 14 SER A 12 ? ? -35.67 144.26 406 14 SER A 15 ? ? -82.46 -152.96 407 14 CYS A 17 ? ? -142.27 -153.44 408 14 GLU A 18 ? ? 57.05 159.02 409 14 THR A 23 ? ? -177.78 146.66 410 14 ASN A 24 ? ? 45.80 96.65 411 14 CYS A 25 ? ? -140.24 -155.40 412 14 TYR A 26 ? ? 163.19 43.67 413 14 LYS A 29 ? ? 175.67 79.57 414 14 SER A 30 ? ? -165.26 -160.48 415 14 GLU A 31 ? ? -137.66 -62.31 416 14 VAL A 32 ? ? 64.61 153.22 417 14 TYR A 33 ? ? -149.86 -77.04 418 14 THR A 36 ? ? -119.52 58.81 419 14 CYS A 37 ? ? -39.03 103.14 420 14 THR A 38 ? ? -106.39 75.84 421 14 ASP A 43 ? ? -155.71 46.93 422 14 THR A 46 ? ? -155.28 57.86 423 14 THR A 48 ? ? -143.06 -81.23 424 14 THR A 53 ? ? -117.49 70.15 425 14 SER A 55 ? ? -171.92 128.09 426 14 SER A 58 ? ? -48.91 156.06 427 14 CYS A 80 ? ? -45.09 167.81 428 14 ILE A 82 ? ? -6.69 73.89 429 14 SER A 83 ? ? -124.35 -52.06 430 14 CYS A 85 ? ? 44.07 -167.82 431 14 THR A 86 ? ? 175.18 140.22 432 14 SER A 88 ? ? -165.52 25.86 433 14 ALA A 89 ? ? 55.02 83.41 434 15 THR A 5 ? ? -171.87 -84.69 435 15 ASN A 6 ? ? 166.13 71.78 436 15 THR A 7 ? ? 63.06 -70.94 437 15 SER A 9 ? ? 74.14 50.53 438 15 LEU A 11 ? ? 10.20 107.24 439 15 SER A 12 ? ? -39.56 155.40 440 15 SER A 15 ? ? -66.24 -161.58 441 15 GLU A 18 ? ? 58.14 -162.77 442 15 LEU A 22 ? ? -37.95 159.99 443 15 CYS A 25 ? ? -120.59 -157.36 444 15 TYR A 26 ? ? -154.82 -55.98 445 15 VAL A 27 ? ? 57.72 119.80 446 15 LYS A 29 ? ? -163.41 59.23 447 15 TYR A 33 ? ? -130.91 -36.41 448 15 CYS A 37 ? ? 42.24 81.13 449 15 PHE A 42 ? ? -120.31 -162.72 450 15 ASP A 43 ? ? 171.98 53.86 451 15 THR A 46 ? ? -161.07 56.52 452 15 THR A 48 ? ? -129.53 -140.04 453 15 SER A 52 ? ? -36.18 133.94 454 15 CYS A 62 ? ? -40.56 103.64 455 15 THR A 66 ? ? 58.02 79.65 456 15 ALA A 75 ? ? -73.15 -153.59 457 15 ALA A 79 ? ? -158.54 40.88 458 15 ILE A 82 ? ? -160.10 53.59 459 15 SER A 83 ? ? -97.95 -126.06 460 15 THR A 86 ? ? -177.43 149.57 461 15 SER A 88 ? ? -148.58 23.91 462 16 THR A 7 ? ? 76.48 -5.02 463 16 ASN A 8 ? ? -160.45 -51.10 464 16 SER A 9 ? ? 85.18 92.79 465 16 LEU A 11 ? ? -41.25 103.18 466 16 SER A 12 ? ? -64.94 55.49 467 16 ALA A 13 ? ? 56.76 154.37 468 16 ASN A 14 ? ? 70.51 -4.68 469 16 GLU A 18 ? ? -169.61 -39.96 470 16 LYS A 19 ? ? -177.62 54.56 471 16 SER A 20 ? ? -102.92 -163.44 472 16 VAL A 27 ? ? 52.99 137.08 473 16 TYR A 33 ? ? -144.93 34.71 474 16 SER A 40 ? ? -122.38 -167.74 475 16 ASP A 43 ? ? -167.80 49.37 476 16 VAL A 45 ? ? -127.87 -166.37 477 16 THR A 46 ? ? -161.37 56.28 478 16 THR A 48 ? ? -138.28 -137.04 479 16 THR A 49 ? ? -65.34 81.99 480 16 CYS A 62 ? ? -39.43 147.25 481 16 THR A 66 ? ? 54.35 80.57 482 16 ILE A 69 ? ? -18.35 138.83 483 16 SER A 88 ? ? -156.48 24.80 484 16 ALA A 89 ? ? 46.61 78.78 485 17 ASN A 6 ? ? 28.54 41.84 486 17 ASN A 8 ? ? 167.81 -25.46 487 17 SER A 9 ? ? 63.75 90.51 488 17 SER A 12 ? ? -58.60 71.15 489 17 ALA A 13 ? ? 21.89 59.87 490 17 ASN A 14 ? ? -178.46 -32.89 491 17 SER A 15 ? ? -58.42 -176.56 492 17 LYS A 19 ? ? -174.12 34.89 493 17 VAL A 27 ? ? -21.67 144.86 494 17 LYS A 29 ? ? 35.43 41.50 495 17 TYR A 33 ? ? -148.44 -14.23 496 17 CYS A 37 ? ? -44.02 102.99 497 17 THR A 38 ? ? -95.84 35.64 498 17 SER A 40 ? ? -115.14 -166.98 499 17 ASP A 43 ? ? -165.81 53.59 500 17 THR A 46 ? ? -165.08 58.46 501 17 THR A 48 ? ? -131.34 -143.34 502 17 SER A 55 ? ? -174.42 110.47 503 17 SER A 58 ? ? -45.36 160.23 504 17 PRO A 60 ? ? -80.70 47.83 505 17 CYS A 62 ? ? -36.62 116.75 506 17 ILE A 68 ? ? -69.49 86.56 507 17 ILE A 82 ? ? -163.23 82.22 508 17 THR A 86 ? ? 168.82 147.14 509 17 SER A 88 ? ? -145.25 30.34 510 17 ALA A 89 ? ? 51.72 82.14 511 18 SER A 3 ? ? -124.42 -76.97 512 18 CYS A 4 ? ? 49.42 -154.29 513 18 THR A 5 ? ? 167.47 -29.00 514 18 THR A 7 ? ? 75.55 -52.05 515 18 ASN A 8 ? ? 176.20 56.64 516 18 SER A 9 ? ? -117.45 -140.54 517 18 GLN A 10 ? ? -132.06 -37.31 518 18 LEU A 11 ? ? 47.57 81.28 519 18 SER A 15 ? ? -91.72 -157.52 520 18 LYS A 19 ? ? 61.83 117.32 521 18 LEU A 22 ? ? -60.95 -178.79 522 18 CYS A 25 ? ? -88.08 -151.12 523 18 TYR A 26 ? ? 174.35 41.77 524 18 LYS A 29 ? ? 55.60 19.37 525 18 GLU A 31 ? ? -116.33 -71.91 526 18 VAL A 32 ? ? 66.45 140.63 527 18 TYR A 33 ? ? -141.34 -70.81 528 18 CYS A 37 ? ? -39.38 104.78 529 18 SER A 40 ? ? -130.80 -150.65 530 18 ARG A 41 ? ? 177.66 -176.68 531 18 ASP A 43 ? ? -171.88 50.70 532 18 VAL A 45 ? ? -138.53 -159.44 533 18 THR A 46 ? ? -161.79 51.04 534 18 THR A 48 ? ? -136.48 -120.04 535 18 SER A 58 ? ? -34.43 146.85 536 18 PRO A 60 ? ? -84.22 36.46 537 18 CYS A 62 ? ? -49.87 166.77 538 18 SER A 65 ? ? -163.09 105.76 539 18 THR A 66 ? ? 67.07 78.20 540 18 LYS A 81 ? ? -60.17 -81.10 541 18 ILE A 82 ? ? 71.96 33.68 542 18 SER A 83 ? ? -112.12 -84.76 543 19 SER A 3 ? ? 59.65 13.35 544 19 ASN A 6 ? ? 35.93 66.18 545 19 THR A 7 ? ? 70.31 -57.59 546 19 ASN A 8 ? ? 169.58 81.69 547 19 SER A 9 ? ? -166.74 -144.81 548 19 LEU A 11 ? ? -178.66 92.80 549 19 SER A 15 ? ? -68.63 -170.22 550 19 CYS A 17 ? ? -110.96 -164.25 551 19 GLU A 18 ? ? 69.71 136.62 552 19 THR A 23 ? ? -163.67 95.00 553 19 CYS A 25 ? ? -59.69 -159.17 554 19 TYR A 26 ? ? 179.77 -43.98 555 19 VAL A 27 ? ? 36.60 -159.68 556 19 ASP A 28 ? ? 171.93 -31.51 557 19 LYS A 29 ? ? -169.28 51.02 558 19 SER A 30 ? ? -127.34 -166.63 559 19 GLU A 31 ? ? -129.09 -65.02 560 19 VAL A 32 ? ? 67.71 147.22 561 19 TYR A 33 ? ? -134.77 -50.98 562 19 THR A 38 ? ? -67.37 66.30 563 19 ASP A 43 ? ? -174.48 49.73 564 19 THR A 46 ? ? -155.70 56.24 565 19 THR A 48 ? ? -139.36 -131.63 566 19 SER A 52 ? ? -39.61 125.02 567 19 CYS A 62 ? ? -42.55 170.15 568 19 SER A 65 ? ? -168.37 113.41 569 19 ILE A 68 ? ? -64.31 82.28 570 19 ILE A 82 ? ? 46.77 71.29 571 19 SER A 83 ? ? -128.79 -106.67 572 19 THR A 86 ? ? 177.44 162.61 573 19 SER A 88 ? ? -146.16 22.65 574 20 CYS A 4 ? ? 59.47 -173.70 575 20 THR A 5 ? ? -153.82 18.82 576 20 ASN A 6 ? ? 18.74 57.39 577 20 ASN A 8 ? ? 60.89 89.63 578 20 SER A 9 ? ? -165.93 -149.22 579 20 SER A 12 ? ? -35.67 133.41 580 20 SER A 15 ? ? -64.54 -176.85 581 20 GLU A 18 ? ? -112.63 -143.42 582 20 CYS A 25 ? ? -67.59 -157.48 583 20 TYR A 26 ? ? 167.11 50.70 584 20 ASP A 28 ? ? -148.39 -35.10 585 20 LYS A 29 ? ? -157.85 64.54 586 20 GLU A 31 ? ? -123.43 -66.14 587 20 VAL A 32 ? ? 69.07 165.89 588 20 TYR A 33 ? ? -159.85 -51.00 589 20 THR A 35 ? ? -49.82 162.16 590 20 CYS A 37 ? ? 50.85 99.85 591 20 ASP A 43 ? ? -166.75 38.01 592 20 THR A 46 ? ? -164.95 56.17 593 20 THR A 48 ? ? -135.39 -138.01 594 20 THR A 49 ? ? -65.02 90.28 595 20 SER A 58 ? ? -42.03 163.19 596 20 THR A 66 ? ? 45.89 70.91 597 20 THR A 70 ? ? -161.00 96.61 598 20 PRO A 76 ? ? -69.13 57.73 599 20 ILE A 82 ? ? -166.64 91.43 600 20 CYS A 85 ? ? -124.55 -150.04 601 20 THR A 86 ? ? 165.05 143.76 602 20 PHE A 87 ? ? -107.10 -65.00 603 20 ALA A 89 ? ? 54.21 85.73 604 21 ASN A 6 ? ? 66.59 -59.83 605 21 THR A 7 ? ? -160.76 -37.25 606 21 ASN A 8 ? ? 178.08 31.74 607 21 SER A 9 ? ? -138.21 -73.21 608 21 LEU A 11 ? ? -176.00 90.38 609 21 SER A 12 ? ? -36.53 137.05 610 21 SER A 15 ? ? -74.66 -158.76 611 21 GLU A 18 ? ? -167.79 114.95 612 21 LYS A 19 ? ? 41.73 -123.33 613 21 SER A 20 ? ? 60.40 160.08 614 21 VAL A 27 ? ? 55.21 141.53 615 21 SER A 30 ? ? -134.82 -157.49 616 21 GLU A 31 ? ? -152.34 -62.55 617 21 VAL A 32 ? ? 61.91 162.97 618 21 TYR A 33 ? ? -155.66 -46.91 619 21 THR A 36 ? ? -106.68 70.31 620 21 THR A 38 ? ? -106.03 60.22 621 21 ASP A 43 ? ? -173.18 81.44 622 21 THR A 46 ? ? -160.40 56.63 623 21 THR A 48 ? ? -136.16 -150.26 624 21 THR A 49 ? ? -46.75 108.23 625 21 CYS A 62 ? ? -37.24 113.70 626 21 CYS A 85 ? ? -175.39 -174.91 627 21 PHE A 87 ? ? -109.00 -63.54 628 21 ALA A 89 ? ? 57.15 96.10 629 22 ASN A 6 ? ? 65.59 -54.78 630 22 THR A 7 ? ? -163.09 -35.56 631 22 ASN A 8 ? ? -176.74 28.25 632 22 SER A 9 ? ? -132.75 -85.47 633 22 GLN A 10 ? ? -165.87 -164.03 634 22 LEU A 11 ? ? -173.39 117.36 635 22 SER A 12 ? ? -35.14 144.74 636 22 SER A 15 ? ? -55.56 -173.01 637 22 CYS A 17 ? ? -116.24 72.02 638 22 TYR A 26 ? ? -130.09 -47.27 639 22 VAL A 27 ? ? 57.46 123.22 640 22 LYS A 29 ? ? -175.65 66.39 641 22 GLU A 31 ? ? -127.88 -63.40 642 22 VAL A 32 ? ? 68.00 135.34 643 22 TYR A 33 ? ? -147.52 46.61 644 22 CYS A 37 ? ? 47.42 70.92 645 22 ASP A 43 ? ? -170.25 48.06 646 22 THR A 46 ? ? -166.06 55.61 647 22 THR A 48 ? ? -128.63 -140.23 648 22 THR A 49 ? ? -60.17 83.44 649 22 SER A 58 ? ? -45.62 156.83 650 22 CYS A 62 ? ? -40.28 159.52 651 22 ILE A 69 ? ? 55.04 164.56 652 22 THR A 70 ? ? -145.23 -106.33 653 22 ILE A 82 ? ? -179.94 40.64 654 22 SER A 83 ? ? -72.78 -96.70 655 22 ALA A 89 ? ? 56.60 83.24 656 23 THR A 5 ? ? -169.90 -83.09 657 23 ASN A 6 ? ? 163.47 50.30 658 23 THR A 7 ? ? 64.64 -64.64 659 23 SER A 9 ? ? 72.94 55.53 660 23 LEU A 11 ? ? -49.51 95.91 661 23 ALA A 13 ? ? -64.48 67.12 662 23 ASN A 14 ? ? 179.90 -31.63 663 23 SER A 15 ? ? -50.62 -176.55 664 23 CYS A 17 ? ? -178.55 148.17 665 23 LYS A 19 ? ? -170.19 43.91 666 23 THR A 23 ? ? -161.74 118.58 667 23 ASN A 24 ? ? 58.58 75.73 668 23 CYS A 25 ? ? -145.50 -157.26 669 23 TYR A 26 ? ? -160.29 -39.56 670 23 VAL A 27 ? ? 53.25 160.19 671 23 ASP A 28 ? ? -171.37 127.32 672 23 TYR A 33 ? ? -139.02 -45.85 673 23 SER A 40 ? ? -122.41 -152.46 674 23 PHE A 42 ? ? -122.49 -169.98 675 23 ASP A 43 ? ? -175.21 48.38 676 23 VAL A 45 ? ? -137.34 -158.84 677 23 THR A 46 ? ? -167.09 58.79 678 23 THR A 48 ? ? -142.24 -148.90 679 23 CYS A 62 ? ? -11.37 121.30 680 23 THR A 66 ? ? 54.05 86.15 681 23 PRO A 76 ? ? -68.87 84.55 682 23 ALA A 78 ? ? 43.80 25.65 683 23 ALA A 79 ? ? -158.59 -40.07 684 23 CYS A 80 ? ? -46.95 169.14 685 23 ILE A 82 ? ? 34.15 79.37 686 23 SER A 83 ? ? -122.74 -98.14 687 23 THR A 86 ? ? 175.62 148.85 688 23 SER A 88 ? ? -153.78 24.35 689 24 ASN A 6 ? ? 36.38 46.17 690 24 THR A 7 ? ? 84.96 -33.81 691 24 ASN A 8 ? ? 179.97 44.96 692 24 SER A 9 ? ? -160.99 -132.41 693 24 GLN A 10 ? ? -113.94 -168.48 694 24 LEU A 11 ? ? -165.23 69.15 695 24 SER A 12 ? ? 42.36 23.96 696 24 ALA A 13 ? ? 41.66 23.20 697 24 ASN A 14 ? ? 174.40 30.35 698 24 SER A 15 ? ? -69.80 -168.66 699 24 CYS A 17 ? ? -91.07 -140.23 700 24 GLU A 18 ? ? 67.35 107.51 701 24 THR A 21 ? ? -150.62 82.18 702 24 LEU A 22 ? ? -124.76 -163.54 703 24 THR A 23 ? ? -165.85 113.53 704 24 ASN A 24 ? ? 59.05 127.67 705 24 CYS A 25 ? ? 172.90 -169.24 706 24 TYR A 26 ? ? -142.35 -46.63 707 24 VAL A 27 ? ? 57.14 133.99 708 24 GLU A 31 ? ? -96.74 -71.02 709 24 VAL A 32 ? ? 59.90 138.56 710 24 TYR A 33 ? ? -140.33 -81.21 711 24 THR A 36 ? ? -116.39 57.32 712 24 CYS A 37 ? ? -40.84 97.82 713 24 THR A 38 ? ? -89.66 48.91 714 24 SER A 40 ? ? -99.44 -154.39 715 24 ASP A 43 ? ? -157.49 61.76 716 24 THR A 46 ? ? -166.17 54.08 717 24 THR A 48 ? ? -140.10 -113.24 718 24 SER A 58 ? ? -40.84 150.50 719 24 THR A 66 ? ? 63.33 82.18 720 24 LYS A 81 ? ? -103.02 -164.12 721 24 ILE A 82 ? ? 175.99 34.78 722 24 SER A 83 ? ? -70.32 -100.64 723 24 SER A 88 ? ? -145.05 12.24 724 25 CYS A 4 ? ? -79.03 -160.11 725 25 THR A 5 ? ? -158.56 10.59 726 25 THR A 7 ? ? 80.71 -25.81 727 25 ASN A 8 ? ? 166.87 65.60 728 25 SER A 9 ? ? -160.33 -121.22 729 25 GLN A 10 ? ? -122.65 -54.83 730 25 LEU A 11 ? ? 48.02 82.42 731 25 SER A 12 ? ? -39.46 137.80 732 25 GLU A 18 ? ? -160.48 -84.48 733 25 ASN A 24 ? ? 56.99 100.70 734 25 TYR A 26 ? ? -134.69 -48.43 735 25 VAL A 27 ? ? 55.22 144.01 736 25 SER A 30 ? ? -123.36 -163.08 737 25 GLU A 31 ? ? -146.21 -72.00 738 25 VAL A 32 ? ? 73.15 141.29 739 25 TYR A 33 ? ? -145.75 35.89 740 25 THR A 36 ? ? -108.45 62.14 741 25 CYS A 37 ? ? -47.02 92.83 742 25 ASP A 43 ? ? -157.85 50.03 743 25 THR A 46 ? ? -166.16 56.47 744 25 THR A 48 ? ? -133.25 -127.06 745 25 SER A 58 ? ? -41.17 155.36 746 25 CYS A 62 ? ? -39.78 108.23 747 25 THR A 66 ? ? 48.37 80.37 748 25 THR A 70 ? ? -166.21 106.49 749 25 ILE A 82 ? ? 179.09 39.01 750 25 ALA A 89 ? ? 51.41 83.68 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 41 ? ? 0.212 'SIDE CHAIN' 2 1 ARG A 56 ? ? 0.295 'SIDE CHAIN' 3 2 ARG A 41 ? ? 0.210 'SIDE CHAIN' 4 2 ARG A 56 ? ? 0.124 'SIDE CHAIN' 5 3 ARG A 41 ? ? 0.247 'SIDE CHAIN' 6 3 ARG A 56 ? ? 0.143 'SIDE CHAIN' 7 4 ARG A 41 ? ? 0.287 'SIDE CHAIN' 8 4 ARG A 56 ? ? 0.291 'SIDE CHAIN' 9 5 ARG A 41 ? ? 0.317 'SIDE CHAIN' 10 5 ARG A 56 ? ? 0.237 'SIDE CHAIN' 11 6 ARG A 41 ? ? 0.213 'SIDE CHAIN' 12 6 ARG A 56 ? ? 0.313 'SIDE CHAIN' 13 7 ARG A 41 ? ? 0.207 'SIDE CHAIN' 14 7 ARG A 56 ? ? 0.258 'SIDE CHAIN' 15 8 ARG A 41 ? ? 0.258 'SIDE CHAIN' 16 8 ARG A 56 ? ? 0.230 'SIDE CHAIN' 17 9 ARG A 41 ? ? 0.298 'SIDE CHAIN' 18 9 ARG A 56 ? ? 0.254 'SIDE CHAIN' 19 10 ARG A 41 ? ? 0.315 'SIDE CHAIN' 20 10 ARG A 56 ? ? 0.318 'SIDE CHAIN' 21 11 ARG A 41 ? ? 0.285 'SIDE CHAIN' 22 11 ARG A 56 ? ? 0.250 'SIDE CHAIN' 23 12 ARG A 41 ? ? 0.242 'SIDE CHAIN' 24 12 ARG A 56 ? ? 0.300 'SIDE CHAIN' 25 13 ARG A 41 ? ? 0.258 'SIDE CHAIN' 26 13 ARG A 56 ? ? 0.108 'SIDE CHAIN' 27 14 ARG A 41 ? ? 0.196 'SIDE CHAIN' 28 14 ARG A 56 ? ? 0.317 'SIDE CHAIN' 29 15 ARG A 41 ? ? 0.309 'SIDE CHAIN' 30 15 ARG A 56 ? ? 0.268 'SIDE CHAIN' 31 16 ARG A 41 ? ? 0.315 'SIDE CHAIN' 32 16 ARG A 56 ? ? 0.078 'SIDE CHAIN' 33 17 ARG A 41 ? ? 0.317 'SIDE CHAIN' 34 17 ARG A 56 ? ? 0.263 'SIDE CHAIN' 35 18 ARG A 41 ? ? 0.314 'SIDE CHAIN' 36 18 ARG A 56 ? ? 0.316 'SIDE CHAIN' 37 19 ARG A 41 ? ? 0.165 'SIDE CHAIN' 38 19 ARG A 56 ? ? 0.209 'SIDE CHAIN' 39 20 ARG A 41 ? ? 0.243 'SIDE CHAIN' 40 20 ARG A 56 ? ? 0.181 'SIDE CHAIN' 41 21 ARG A 41 ? ? 0.259 'SIDE CHAIN' 42 21 ARG A 56 ? ? 0.312 'SIDE CHAIN' 43 22 ARG A 41 ? ? 0.234 'SIDE CHAIN' 44 22 ARG A 56 ? ? 0.316 'SIDE CHAIN' 45 23 ARG A 41 ? ? 0.292 'SIDE CHAIN' 46 23 ARG A 56 ? ? 0.305 'SIDE CHAIN' 47 24 ARG A 41 ? ? 0.317 'SIDE CHAIN' 48 24 ARG A 56 ? ? 0.162 'SIDE CHAIN' 49 25 ARG A 41 ? ? 0.304 'SIDE CHAIN' 50 25 ARG A 56 ? ? 0.157 'SIDE CHAIN' #