data_1NKU # _entry.id 1NKU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1NKU pdb_00001nku 10.2210/pdb1nku/pdb RCSB RCSB017959 ? ? WWPDB D_1000017959 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-06-03 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.value' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 16 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 17 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 27 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 28 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 29 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1NKU _pdbx_database_status.recvd_initial_deposition_date 2003-01-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1LMZ _pdbx_database_related.details 'The solution structure of TAG without zinc' _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kwon, K.' 1 'Cao, C.' 2 'Stivers, J.T.' 3 # _citation.id primary _citation.title 'A Novel Zinc Snap Motif Conveys Structural Stability to 3-Methyladenine DNA Glycosylase I' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 19442 _citation.page_last 19446 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12654914 _citation.pdbx_database_id_DOI 10.1074/jbc.M300934200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kwon, K.' 1 ? primary 'Cao, C.' 2 ? primary 'Stivers, J.T.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3-Methyladenine Dna Glycosylase I (TAG)' 21138.135 1 3.2.2.20 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLV QDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTT ICYSFMQACGLVNDHVVGCCCYPGNKP ; _entity_poly.pdbx_seq_one_letter_code_can ;MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLV QDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTT ICYSFMQACGLVNDHVVGCCCYPGNKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 CYS n 1 5 GLY n 1 6 TRP n 1 7 VAL n 1 8 SER n 1 9 GLN n 1 10 ASP n 1 11 PRO n 1 12 LEU n 1 13 TYR n 1 14 ILE n 1 15 ALA n 1 16 TYR n 1 17 HIS n 1 18 ASP n 1 19 ASN n 1 20 GLU n 1 21 TRP n 1 22 GLY n 1 23 VAL n 1 24 PRO n 1 25 GLU n 1 26 THR n 1 27 ASP n 1 28 SER n 1 29 LYS n 1 30 LYS n 1 31 LEU n 1 32 PHE n 1 33 GLU n 1 34 MET n 1 35 ILE n 1 36 CYS n 1 37 LEU n 1 38 GLU n 1 39 GLY n 1 40 GLN n 1 41 GLN n 1 42 ALA n 1 43 GLY n 1 44 LEU n 1 45 SER n 1 46 TRP n 1 47 ILE n 1 48 THR n 1 49 VAL n 1 50 LEU n 1 51 LYS n 1 52 LYS n 1 53 ARG n 1 54 GLU n 1 55 ASN n 1 56 TYR n 1 57 ARG n 1 58 ALA n 1 59 CYS n 1 60 PHE n 1 61 HIS n 1 62 GLN n 1 63 PHE n 1 64 ASP n 1 65 PRO n 1 66 VAL n 1 67 LYS n 1 68 VAL n 1 69 ALA n 1 70 ALA n 1 71 MET n 1 72 GLN n 1 73 GLU n 1 74 GLU n 1 75 ASP n 1 76 VAL n 1 77 GLU n 1 78 ARG n 1 79 LEU n 1 80 VAL n 1 81 GLN n 1 82 ASP n 1 83 ALA n 1 84 GLY n 1 85 ILE n 1 86 ILE n 1 87 ARG n 1 88 HIS n 1 89 ARG n 1 90 GLY n 1 91 LYS n 1 92 ILE n 1 93 GLN n 1 94 ALA n 1 95 ILE n 1 96 ILE n 1 97 GLY n 1 98 ASN n 1 99 ALA n 1 100 ARG n 1 101 ALA n 1 102 TYR n 1 103 LEU n 1 104 GLN n 1 105 MET n 1 106 GLU n 1 107 GLN n 1 108 ASN n 1 109 GLY n 1 110 GLU n 1 111 PRO n 1 112 PHE n 1 113 ALA n 1 114 ASP n 1 115 PHE n 1 116 VAL n 1 117 TRP n 1 118 SER n 1 119 PHE n 1 120 VAL n 1 121 ASN n 1 122 HIS n 1 123 GLN n 1 124 PRO n 1 125 GLN n 1 126 MET n 1 127 THR n 1 128 GLN n 1 129 ALA n 1 130 THR n 1 131 THR n 1 132 LEU n 1 133 SER n 1 134 GLU n 1 135 ILE n 1 136 PRO n 1 137 THR n 1 138 SER n 1 139 THR n 1 140 PRO n 1 141 ALA n 1 142 SER n 1 143 ASP n 1 144 ALA n 1 145 LEU n 1 146 SER n 1 147 LYS n 1 148 ALA n 1 149 LEU n 1 150 LYS n 1 151 LYS n 1 152 ARG n 1 153 GLY n 1 154 PHE n 1 155 LYS n 1 156 PHE n 1 157 VAL n 1 158 GLY n 1 159 THR n 1 160 THR n 1 161 ILE n 1 162 CYS n 1 163 TYR n 1 164 SER n 1 165 PHE n 1 166 MET n 1 167 GLN n 1 168 ALA n 1 169 CYS n 1 170 GLY n 1 171 LEU n 1 172 VAL n 1 173 ASN n 1 174 ASP n 1 175 HIS n 1 176 VAL n 1 177 VAL n 1 178 GLY n 1 179 CYS n 1 180 CYS n 1 181 CYS n 1 182 TYR n 1 183 PRO n 1 184 GLY n 1 185 ASN n 1 186 LYS n 1 187 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 TRP 21 21 21 TRP TRP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 CYS 36 36 36 CYS CYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 CYS 59 59 59 CYS CYS A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 PHE 115 115 115 PHE PHE A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 MET 126 126 126 MET MET A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 PHE 154 154 154 PHE PHE A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 PHE 156 156 156 PHE PHE A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 GLY 158 158 158 GLY GLY A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PHE 165 165 165 PHE PHE A . n A 1 166 MET 166 166 166 MET MET A . n A 1 167 GLN 167 167 167 GLN GLN A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 LEU 171 171 171 LEU LEU A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 ASP 174 174 174 ASP ASP A . n A 1 175 HIS 175 175 175 HIS HIS A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 CYS 179 179 179 CYS CYS A . n A 1 180 CYS 180 180 180 CYS CYS A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 TYR 182 182 182 TYR TYR A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 GLY 184 184 184 GLY GLY A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 PRO 187 187 187 PRO PRO A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 188 _pdbx_nonpoly_scheme.auth_seq_num 188 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 1NKU _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1NKU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1NKU _struct.title 'NMR Solution Structure of Zinc-binding protein 3-methyladenine DNA glycosylase I (TAG)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1NKU _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 3MG1_ECOLI _struct_ref.pdbx_db_accession P05100 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1NKU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 187 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P05100 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 187 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 187 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 10 ? GLU A 20 ? ASP A 10 GLU A 20 1 ? 11 HELX_P HELX_P2 2 ASP A 27 ? ALA A 42 ? ASP A 27 ALA A 42 1 ? 16 HELX_P HELX_P3 3 SER A 45 ? HIS A 61 ? SER A 45 HIS A 61 1 ? 17 HELX_P HELX_P4 4 ASP A 64 ? ALA A 70 ? ASP A 64 ALA A 70 1 ? 7 HELX_P HELX_P5 5 GLN A 72 ? GLN A 81 ? GLN A 72 GLN A 81 1 ? 10 HELX_P HELX_P6 6 HIS A 88 ? ASN A 108 ? HIS A 88 ASN A 108 1 ? 21 HELX_P HELX_P7 7 PRO A 111 ? VAL A 120 ? PRO A 111 VAL A 120 1 ? 10 HELX_P HELX_P8 8 THR A 131 ? ILE A 135 ? THR A 131 ILE A 135 5 ? 5 HELX_P HELX_P9 9 THR A 139 ? GLY A 153 ? THR A 139 GLY A 153 1 ? 15 HELX_P HELX_P10 10 GLY A 158 ? GLY A 170 ? GLY A 158 GLY A 170 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 4 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 4 A ZN 188 1_555 ? ? ? ? ? ? ? 2.296 ? ? metalc2 metalc ? ? A HIS 17 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 17 A ZN 188 1_555 ? ? ? ? ? ? ? 2.009 ? ? metalc3 metalc ? ? A HIS 175 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 175 A ZN 188 1_555 ? ? ? ? ? ? ? 2.002 ? ? metalc4 metalc ? ? A CYS 179 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 179 A ZN 188 1_555 ? ? ? ? ? ? ? 2.297 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 106.8 ? 2 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 ND1 ? A HIS 175 ? A HIS 175 ? 1_555 113.3 ? 3 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 ND1 ? A HIS 175 ? A HIS 175 ? 1_555 108.5 ? 4 SG ? A CYS 4 ? A CYS 4 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 SG ? A CYS 179 ? A CYS 179 ? 1_555 107.4 ? 5 NE2 ? A HIS 17 ? A HIS 17 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 SG ? A CYS 179 ? A CYS 179 ? 1_555 111.3 ? 6 ND1 ? A HIS 175 ? A HIS 175 ? 1_555 ZN ? B ZN . ? A ZN 188 ? 1_555 SG ? A CYS 179 ? A CYS 179 ? 1_555 109.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 125 ? MET A 126 ? GLN A 125 MET A 126 A 2 VAL A 172 ? ASN A 173 ? VAL A 172 ASN A 173 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLN _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 125 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 125 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ASN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 173 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ASN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 173 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 188 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 188' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 4 ? CYS A 4 . ? 1_555 ? 2 AC1 5 HIS A 17 ? HIS A 17 . ? 1_555 ? 3 AC1 5 TRP A 21 ? TRP A 21 . ? 1_555 ? 4 AC1 5 HIS A 175 ? HIS A 175 . ? 1_555 ? 5 AC1 5 CYS A 179 ? CYS A 179 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A CYS 179 ? ? H A CYS 181 ? ? 1.53 2 1 O A LYS 52 ? ? H A TYR 56 ? ? 1.59 3 2 H2 A MET 1 ? ? HH12 A ARG 3 ? ? 1.31 4 2 O A TYR 56 ? ? H A PHE 60 ? ? 1.54 5 2 OD2 A ASP 64 ? ? H A LYS 67 ? ? 1.55 6 2 O A HIS 88 ? ? H A GLY 90 ? ? 1.55 7 2 O A VAL 49 ? ? H A ARG 53 ? ? 1.60 8 3 O A THR 127 ? ? HH A TYR 182 ? ? 1.34 9 3 H A THR 130 ? ? OE1 A GLU 134 ? ? 1.41 10 3 O A LYS 52 ? ? H A TYR 56 ? ? 1.51 11 4 O A CYS 179 ? ? H A TYR 182 ? ? 1.50 12 4 O A GLN 41 ? ? H A LEU 44 ? ? 1.58 13 4 O A ARG 78 ? ? H A ASP 82 ? ? 1.60 14 5 OD1 A ASP 64 ? ? H A LYS 67 ? ? 1.46 15 5 O A CYS 179 ? ? H A CYS 181 ? ? 1.57 16 5 O A LYS 52 ? ? H A TYR 56 ? ? 1.59 17 6 O A GLN 41 ? ? H A LEU 44 ? ? 1.45 18 6 O A VAL 176 ? ? H A GLY 178 ? ? 1.50 19 6 O A ALA 15 ? ? H A ASN 19 ? ? 1.53 20 7 O A GLN 41 ? ? H A LEU 44 ? ? 1.41 21 7 O A GLY 84 ? ? H A ILE 86 ? ? 1.44 22 7 O A PHE 165 ? ? H A CYS 169 ? ? 1.48 23 7 O A LYS 52 ? ? H A TYR 56 ? ? 1.57 24 8 O A CYS 179 ? ? H A CYS 181 ? ? 1.41 25 8 OD1 A ASP 174 ? ? H A HIS 175 ? ? 1.45 26 8 O A GLN 41 ? ? H A LEU 44 ? ? 1.47 27 8 O A LYS 52 ? ? H A TYR 56 ? ? 1.50 28 9 O A TYR 56 ? ? H A PHE 60 ? ? 1.42 29 9 O A CYS 179 ? ? H A CYS 181 ? ? 1.45 30 10 O A GLN 41 ? ? H A LEU 44 ? ? 1.44 31 10 H A GLY 178 ? ? O A TYR 182 ? ? 1.58 32 10 O A HIS 88 ? ? H A GLY 90 ? ? 1.58 33 11 O A ALA 58 ? ? HE21 A GLN 62 ? ? 1.37 34 11 O A GLY 178 ? ? H A CYS 180 ? ? 1.43 35 11 O A GLN 41 ? ? H A LEU 44 ? ? 1.52 36 11 O A LYS 52 ? ? H A TYR 56 ? ? 1.59 37 12 HE1 A TRP 21 ? ? HE21 A GLN 167 ? ? 1.26 38 12 H A THR 130 ? ? OE1 A GLU 134 ? ? 1.39 39 12 HH A TYR 163 ? ? OD2 A ASP 174 ? ? 1.43 40 12 O A GLY 170 ? ? H A VAL 172 ? ? 1.44 41 12 O A GLU 106 ? ? H A GLY 109 ? ? 1.60 42 13 HG A SER 28 ? ? HH A TYR 102 ? ? 1.30 43 13 O A GLN 41 ? ? H A LEU 44 ? ? 1.51 44 13 H A THR 130 ? ? OE1 A GLU 134 ? ? 1.57 45 13 O A CYS 179 ? ? H A CYS 181 ? ? 1.58 46 13 O A LYS 52 ? ? H A TYR 56 ? ? 1.58 47 14 O A THR 127 ? ? HH A TYR 182 ? ? 1.34 48 14 H A THR 130 ? ? OE1 A GLU 134 ? ? 1.41 49 14 O A LYS 52 ? ? H A TYR 56 ? ? 1.51 50 15 O A LYS 52 ? ? H A TYR 56 ? ? 1.49 51 15 O A GLN 41 ? ? H A LEU 44 ? ? 1.51 52 15 O A GLU 106 ? ? H A GLY 109 ? ? 1.57 53 15 O A TYR 13 ? ? H A HIS 17 ? ? 1.60 54 16 HG A SER 28 ? ? OH A TYR 102 ? ? 1.38 55 16 O A GLN 41 ? ? H A LEU 44 ? ? 1.45 56 16 O A CYS 179 ? ? H A CYS 181 ? ? 1.45 57 16 O A ASP 82 ? ? HE A ARG 87 ? ? 1.56 58 16 O A GLU 2 ? ? H A CYS 180 ? ? 1.58 59 16 O A VAL 49 ? ? H A ARG 53 ? ? 1.59 60 17 O A GLN 41 ? ? H A LEU 44 ? ? 1.41 61 17 O A HIS 88 ? ? H A ILE 92 ? ? 1.45 62 17 O A TRP 117 ? ? H A HIS 122 ? ? 1.56 63 17 O A PHE 112 ? ? H A VAL 116 ? ? 1.58 64 18 OD1 A ASP 82 ? ? H A ALA 83 ? ? 1.47 65 18 O A TYR 56 ? ? H A PHE 60 ? ? 1.54 66 18 O A LYS 52 ? ? H A TYR 56 ? ? 1.55 67 18 O A GLN 123 ? ? HE21 A GLN 125 ? ? 1.57 68 18 O A GLN 62 ? ? H A ASP 64 ? ? 1.57 69 19 O A GLN 41 ? ? H A LEU 44 ? ? 1.40 70 19 O A CYS 179 ? ? H A TYR 182 ? ? 1.49 71 19 O A LYS 52 ? ? H A TYR 56 ? ? 1.59 72 19 O A VAL 49 ? ? H A ARG 53 ? ? 1.59 73 19 OD1 A ASN 108 ? ? H A GLU 110 ? ? 1.60 74 20 HG1 A THR 131 ? ? H A LEU 132 ? ? 1.30 75 20 O A GLY 178 ? ? H A CYS 180 ? ? 1.46 76 20 O A LYS 52 ? ? H A TYR 56 ? ? 1.58 77 20 O A PHE 165 ? ? H A CYS 169 ? ? 1.59 78 21 O A ILE 85 ? ? H A ARG 87 ? ? 1.55 79 21 O A LYS 52 ? ? H A TYR 56 ? ? 1.56 80 22 O A GLN 123 ? ? HE21 A GLN 125 ? ? 1.47 81 23 HE1 A TRP 21 ? ? HE21 A GLN 167 ? ? 1.21 82 23 O A GLU 33 ? ? HH12 A ARG 53 ? ? 1.54 83 23 O A CYS 179 ? ? H A CYS 181 ? ? 1.55 84 23 O A LYS 52 ? ? H A TYR 56 ? ? 1.55 85 23 O A GLN 41 ? ? H A LEU 44 ? ? 1.55 86 23 H A GLN 125 ? ? O A LEU 171 ? ? 1.59 87 24 O A GLN 41 ? ? H A LEU 44 ? ? 1.50 88 24 HD22 A ASN 55 ? ? O A GLY 84 ? ? 1.59 89 24 O A LYS 52 ? ? H A TYR 56 ? ? 1.59 90 25 O A SER 8 ? ? H A ASP 10 ? ? 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? -168.05 -139.71 2 1 ASP A 10 ? ? 46.14 89.44 3 1 GLU A 20 ? ? -157.14 -114.49 4 1 TRP A 21 ? ? 49.62 100.58 5 1 ASP A 64 ? ? 68.85 172.13 6 1 HIS A 88 ? ? -179.92 90.44 7 1 HIS A 122 ? ? 44.54 13.55 8 1 VAL A 176 ? ? 38.19 -163.09 9 1 CYS A 180 ? ? 62.17 -63.75 10 1 ASN A 185 ? ? -173.35 27.64 11 2 SER A 8 ? ? -169.57 119.82 12 2 GLN A 9 ? ? 38.69 -152.27 13 2 ASP A 10 ? ? 44.75 74.66 14 2 ASN A 19 ? ? -80.16 -73.69 15 2 TRP A 21 ? ? -175.74 99.10 16 2 PHE A 63 ? ? -54.72 18.24 17 2 MET A 71 ? ? -52.39 171.39 18 2 ILE A 86 ? ? -59.87 91.96 19 2 HIS A 88 ? ? -148.25 34.06 20 2 ARG A 89 ? ? 59.20 -65.70 21 2 HIS A 175 ? ? -133.38 -117.76 22 3 ASN A 19 ? ? -72.26 -71.23 23 3 TRP A 21 ? ? -175.32 103.24 24 3 ALA A 42 ? ? -47.72 109.89 25 3 LEU A 44 ? ? -77.94 -165.38 26 3 PHE A 63 ? ? -101.37 68.24 27 3 ASP A 64 ? ? -36.11 162.25 28 3 ALA A 83 ? ? 164.09 82.50 29 3 ILE A 85 ? ? -58.14 -147.08 30 3 HIS A 88 ? ? -178.34 101.54 31 3 HIS A 122 ? ? 51.97 11.82 32 3 HIS A 175 ? ? 123.67 -119.49 33 3 CYS A 179 ? ? -69.90 61.25 34 3 CYS A 180 ? ? 34.31 -87.64 35 3 PRO A 183 ? ? -82.26 -102.34 36 4 TRP A 6 ? ? 44.42 16.01 37 4 GLN A 9 ? ? -175.40 69.20 38 4 GLU A 20 ? ? -153.78 -124.58 39 4 TRP A 21 ? ? 57.56 93.43 40 4 LEU A 44 ? ? -111.23 -141.25 41 4 ASP A 64 ? ? 62.80 148.33 42 4 ALA A 83 ? ? 92.29 -31.29 43 4 HIS A 88 ? ? -164.25 14.77 44 4 ARG A 89 ? ? 53.30 -70.43 45 4 HIS A 122 ? ? 42.95 18.28 46 4 THR A 137 ? ? 52.24 -2.03 47 4 HIS A 175 ? ? -122.52 -67.45 48 4 VAL A 176 ? ? -159.57 -89.89 49 4 VAL A 177 ? ? -150.52 -35.36 50 4 CYS A 179 ? ? -64.74 79.71 51 4 CYS A 180 ? ? 25.44 -83.70 52 5 SER A 8 ? ? -149.90 -61.42 53 5 GLU A 20 ? ? -168.89 -104.53 54 5 TRP A 21 ? ? 52.03 98.40 55 5 ALA A 42 ? ? -41.64 108.73 56 5 ASP A 64 ? ? 72.35 159.22 57 5 ALA A 83 ? ? -177.05 -50.17 58 5 HIS A 88 ? ? 166.06 105.23 59 5 HIS A 122 ? ? 59.95 -7.27 60 5 GLN A 128 ? ? -158.56 46.91 61 5 ALA A 129 ? ? -111.45 -127.01 62 5 THR A 130 ? ? -164.73 -30.79 63 5 HIS A 175 ? ? -125.68 -81.61 64 5 VAL A 176 ? ? -174.80 -125.57 65 5 CYS A 179 ? ? -74.65 28.56 66 5 CYS A 180 ? ? 62.57 -66.44 67 6 VAL A 7 ? ? -66.02 -127.56 68 6 SER A 8 ? ? 79.62 113.33 69 6 ASP A 10 ? ? -160.96 62.63 70 6 GLU A 20 ? ? -179.39 104.09 71 6 TRP A 21 ? ? -163.71 107.62 72 6 ALA A 42 ? ? -43.27 109.68 73 6 LEU A 44 ? ? -119.21 -163.56 74 6 ASP A 64 ? ? 71.13 147.59 75 6 ALA A 83 ? ? 86.60 86.16 76 6 ILE A 85 ? ? -57.10 -154.91 77 6 HIS A 88 ? ? 179.56 92.74 78 6 HIS A 122 ? ? 42.92 23.19 79 6 THR A 137 ? ? 54.49 -4.03 80 6 HIS A 175 ? ? -121.50 -90.75 81 6 VAL A 176 ? ? -175.97 138.75 82 6 VAL A 177 ? ? -64.52 36.56 83 7 GLN A 9 ? ? 86.19 35.69 84 7 GLU A 20 ? ? -153.75 -117.00 85 7 TRP A 21 ? ? 55.16 95.06 86 7 ALA A 42 ? ? -44.45 109.79 87 7 LEU A 44 ? ? -122.43 -161.86 88 7 ASP A 64 ? ? 64.96 151.27 89 7 ALA A 83 ? ? 88.25 83.42 90 7 ILE A 85 ? ? -62.58 38.61 91 7 ILE A 86 ? ? 58.01 6.94 92 7 HIS A 122 ? ? 45.42 11.64 93 8 ASP A 10 ? ? 60.99 132.13 94 8 GLU A 20 ? ? -178.68 99.18 95 8 TRP A 21 ? ? -169.67 106.31 96 8 ASP A 64 ? ? 52.22 169.74 97 8 ALA A 83 ? ? 82.92 83.51 98 8 ILE A 85 ? ? -57.87 76.80 99 8 ILE A 86 ? ? 56.01 150.72 100 8 HIS A 88 ? ? -178.31 75.37 101 8 HIS A 175 ? ? 137.28 38.13 102 8 VAL A 176 ? ? 34.02 111.62 103 8 CYS A 179 ? ? -59.12 79.92 104 8 CYS A 180 ? ? 64.40 -42.71 105 8 CYS A 181 ? ? 179.91 69.19 106 9 GLN A 9 ? ? -42.12 164.72 107 9 ASP A 10 ? ? 75.80 82.09 108 9 ASN A 19 ? ? -73.01 -70.96 109 9 TRP A 21 ? ? -175.79 103.86 110 9 PHE A 63 ? ? -55.38 8.15 111 9 ASP A 64 ? ? -44.07 150.16 112 9 ALA A 83 ? ? 48.00 3.57 113 9 ILE A 85 ? ? -39.97 112.90 114 9 ILE A 86 ? ? 33.79 -155.92 115 9 ARG A 89 ? ? 61.22 -79.40 116 9 HIS A 175 ? ? 142.74 -1.23 117 9 VAL A 176 ? ? 74.07 136.20 118 9 CYS A 179 ? ? -63.11 3.11 119 9 CYS A 180 ? ? 65.86 -53.68 120 9 PRO A 183 ? ? -61.85 -138.98 121 10 ASP A 10 ? ? 172.02 144.74 122 10 ASN A 19 ? ? -78.72 -74.49 123 10 TRP A 21 ? ? -176.62 101.72 124 10 ALA A 42 ? ? -44.27 109.54 125 10 ASP A 64 ? ? -35.15 158.67 126 10 ALA A 83 ? ? 90.93 -32.07 127 10 HIS A 88 ? ? -167.87 -21.65 128 10 ARG A 89 ? ? 57.81 -66.65 129 10 GLN A 128 ? ? -141.64 47.05 130 10 ALA A 129 ? ? -112.20 -169.26 131 10 VAL A 176 ? ? 99.85 150.96 132 10 CYS A 179 ? ? 39.69 22.63 133 10 CYS A 180 ? ? 53.41 -1.13 134 10 ASN A 185 ? ? -143.71 20.83 135 11 SER A 8 ? ? 40.59 -130.12 136 11 ASP A 10 ? ? -31.74 95.86 137 11 GLU A 20 ? ? -176.42 120.07 138 11 TRP A 21 ? ? -173.37 109.83 139 11 LEU A 44 ? ? -106.79 -144.11 140 11 ASP A 64 ? ? 54.09 168.31 141 11 ALA A 83 ? ? 179.40 -72.41 142 11 ILE A 85 ? ? -98.59 -118.54 143 11 HIS A 88 ? ? 171.84 86.67 144 11 HIS A 175 ? ? -125.87 -121.61 145 11 VAL A 177 ? ? -57.73 78.05 146 11 CYS A 179 ? ? -64.68 40.92 147 11 CYS A 180 ? ? 57.57 -72.98 148 12 CYS A 4 ? ? -123.67 -155.84 149 12 TRP A 6 ? ? 52.26 5.30 150 12 ASP A 10 ? ? 84.60 86.13 151 12 ASN A 19 ? ? -76.36 -73.78 152 12 TRP A 21 ? ? -177.17 92.23 153 12 ALA A 42 ? ? -43.88 108.30 154 12 ASP A 64 ? ? -35.03 158.77 155 12 ALA A 83 ? ? 52.82 -0.95 156 12 ILE A 85 ? ? -54.19 -162.66 157 12 ILE A 86 ? ? -49.38 -177.21 158 12 HIS A 88 ? ? -122.41 -165.90 159 12 ARG A 89 ? ? 59.57 -80.11 160 12 LEU A 171 ? ? 64.43 -37.31 161 12 HIS A 175 ? ? -125.24 -75.40 162 12 VAL A 176 ? ? 167.98 134.89 163 12 CYS A 180 ? ? 59.61 -74.18 164 12 CYS A 181 ? ? -156.76 59.47 165 12 ASN A 185 ? ? -171.98 16.16 166 13 SER A 8 ? ? -79.50 -88.61 167 13 GLN A 9 ? ? -164.12 -33.61 168 13 ASN A 19 ? ? -69.42 -72.51 169 13 TRP A 21 ? ? -176.44 92.57 170 13 LEU A 44 ? ? -116.69 -169.43 171 13 ASP A 64 ? ? 66.12 151.59 172 13 ALA A 83 ? ? 83.93 85.65 173 13 ILE A 85 ? ? -46.43 -99.33 174 13 HIS A 88 ? ? 178.08 88.32 175 13 HIS A 122 ? ? 45.24 13.11 176 13 VAL A 176 ? ? 58.11 160.97 177 13 CYS A 179 ? ? -70.50 30.40 178 13 CYS A 180 ? ? 64.82 -65.83 179 14 ASN A 19 ? ? -72.26 -71.23 180 14 TRP A 21 ? ? -175.32 103.24 181 14 ALA A 42 ? ? -47.72 109.89 182 14 LEU A 44 ? ? -77.94 -165.38 183 14 PHE A 63 ? ? -101.37 68.24 184 14 ASP A 64 ? ? -36.11 162.25 185 14 ALA A 83 ? ? 164.09 82.50 186 14 ILE A 85 ? ? -58.14 -147.08 187 14 HIS A 88 ? ? -178.34 101.54 188 14 HIS A 122 ? ? 51.97 11.82 189 14 HIS A 175 ? ? 123.67 -119.49 190 14 CYS A 179 ? ? -69.90 61.25 191 14 CYS A 180 ? ? 34.31 -87.64 192 14 PRO A 183 ? ? -82.26 -102.34 193 15 SER A 8 ? ? -149.06 -56.88 194 15 ASP A 10 ? ? 85.59 89.28 195 15 TRP A 21 ? ? 57.44 117.24 196 15 ASP A 64 ? ? 60.61 153.26 197 15 ALA A 83 ? ? -115.89 -84.39 198 15 ILE A 86 ? ? -52.13 -159.28 199 15 ARG A 89 ? ? 60.07 -77.48 200 15 HIS A 122 ? ? 46.24 29.56 201 15 ALA A 129 ? ? -106.23 -131.20 202 15 THR A 130 ? ? -160.62 -33.17 203 15 HIS A 175 ? ? -141.21 -75.19 204 15 VAL A 176 ? ? 177.61 177.49 205 15 CYS A 179 ? ? 42.28 19.58 206 15 CYS A 180 ? ? 57.48 -4.76 207 15 PRO A 183 ? ? -79.05 -71.69 208 15 ASN A 185 ? ? -177.77 28.60 209 16 SER A 8 ? ? 38.71 -90.10 210 16 ASP A 10 ? ? 83.70 90.66 211 16 GLU A 20 ? ? 176.45 63.55 212 16 ALA A 42 ? ? -42.20 108.90 213 16 ASP A 64 ? ? 56.06 163.25 214 16 HIS A 88 ? ? -151.57 27.62 215 16 ARG A 89 ? ? 54.72 -75.60 216 16 HIS A 122 ? ? 46.05 29.85 217 16 GLN A 128 ? ? -143.04 39.28 218 16 VAL A 176 ? ? 106.19 144.49 219 16 CYS A 179 ? ? -69.33 90.89 220 16 CYS A 180 ? ? 64.59 -56.09 221 16 CYS A 181 ? ? -174.17 71.09 222 17 GLU A 20 ? ? -157.79 -110.41 223 17 TRP A 21 ? ? 55.39 95.30 224 17 ALA A 42 ? ? -42.35 109.74 225 17 LEU A 44 ? ? -116.27 -148.17 226 17 PHE A 63 ? ? 39.32 39.86 227 17 ALA A 83 ? ? 63.94 -25.22 228 17 ILE A 85 ? ? 30.12 58.86 229 17 ILE A 86 ? ? 56.80 159.51 230 17 HIS A 175 ? ? 118.15 25.33 231 17 VAL A 176 ? ? 49.08 165.94 232 17 CYS A 179 ? ? -59.46 101.11 233 18 CYS A 4 ? ? -39.93 148.50 234 18 SER A 8 ? ? -172.99 53.00 235 18 GLN A 9 ? ? -145.52 -104.80 236 18 TRP A 21 ? ? -174.08 96.50 237 18 ALA A 42 ? ? -41.73 109.88 238 18 PHE A 63 ? ? -67.80 41.96 239 18 GLN A 81 ? ? -100.84 40.11 240 18 ASP A 82 ? ? -52.40 171.57 241 18 ILE A 85 ? ? -54.27 -170.51 242 18 HIS A 88 ? ? 177.16 100.50 243 18 HIS A 175 ? ? -123.18 -95.90 244 18 VAL A 176 ? ? 171.89 144.00 245 18 CYS A 181 ? ? 157.60 -18.85 246 18 PRO A 183 ? ? -83.57 31.72 247 19 SER A 8 ? ? 42.11 -89.24 248 19 ASP A 10 ? ? 82.05 87.38 249 19 ASN A 19 ? ? -81.39 -75.10 250 19 TRP A 21 ? ? -173.39 103.49 251 19 ALA A 42 ? ? -43.65 108.66 252 19 ASP A 64 ? ? -36.05 160.50 253 19 ALA A 83 ? ? 84.33 85.55 254 19 ILE A 85 ? ? -53.30 -167.82 255 19 HIS A 88 ? ? 179.81 86.90 256 19 HIS A 122 ? ? 43.34 29.59 257 19 SER A 138 ? ? -153.24 80.88 258 19 HIS A 175 ? ? 135.40 3.70 259 19 VAL A 176 ? ? 69.03 128.97 260 19 CYS A 179 ? ? -60.00 95.91 261 19 CYS A 180 ? ? -35.84 -35.80 262 20 SER A 8 ? ? 164.64 0.05 263 20 ASP A 10 ? ? -42.11 153.61 264 20 GLU A 20 ? ? 177.67 68.77 265 20 ALA A 42 ? ? -42.20 109.93 266 20 ASP A 64 ? ? 57.58 162.75 267 20 ALA A 83 ? ? -176.60 -67.95 268 20 SER A 138 ? ? -152.16 78.81 269 20 HIS A 175 ? ? -124.62 -93.18 270 20 VAL A 176 ? ? 173.48 132.33 271 20 CYS A 179 ? ? -66.57 55.44 272 20 CYS A 180 ? ? 41.84 -86.18 273 21 SER A 8 ? ? 166.18 12.91 274 21 GLN A 9 ? ? -119.37 -134.47 275 21 GLU A 20 ? ? 175.10 122.49 276 21 TRP A 21 ? ? -171.22 92.34 277 21 ALA A 42 ? ? -42.05 109.60 278 21 ASP A 64 ? ? 59.36 150.01 279 21 ILE A 86 ? ? -65.23 66.31 280 21 HIS A 122 ? ? 43.30 18.28 281 21 HIS A 175 ? ? -146.65 23.42 282 21 VAL A 176 ? ? 56.72 165.20 283 21 CYS A 179 ? ? -71.23 24.83 284 21 CYS A 180 ? ? 72.58 -64.16 285 21 PRO A 183 ? ? -72.36 -74.34 286 21 ASN A 185 ? ? -149.33 30.25 287 22 SER A 8 ? ? -171.72 115.96 288 22 GLN A 9 ? ? 44.96 -170.81 289 22 ASP A 10 ? ? 54.12 73.23 290 22 GLU A 20 ? ? -146.47 -136.85 291 22 TRP A 21 ? ? 57.09 103.19 292 22 ALA A 42 ? ? -41.80 109.74 293 22 ASP A 64 ? ? 59.45 150.14 294 22 ALA A 83 ? ? -135.50 -68.61 295 22 HIS A 88 ? ? 171.15 82.77 296 22 HIS A 122 ? ? 44.30 28.68 297 22 THR A 137 ? ? 50.65 -0.24 298 22 VAL A 176 ? ? 67.18 164.48 299 22 CYS A 179 ? ? -62.55 3.90 300 22 CYS A 180 ? ? 70.96 -52.00 301 22 PRO A 183 ? ? -80.81 -71.18 302 23 ASN A 19 ? ? -67.63 -70.65 303 23 TRP A 21 ? ? -172.67 104.73 304 23 LEU A 44 ? ? -121.52 -165.72 305 23 ASP A 64 ? ? 56.19 161.10 306 23 ALA A 83 ? ? 66.37 -16.09 307 23 ILE A 85 ? ? -59.51 -146.86 308 23 HIS A 88 ? ? 166.37 83.78 309 23 HIS A 175 ? ? -134.65 -62.25 310 23 VAL A 176 ? ? 175.07 -98.45 311 23 VAL A 177 ? ? -152.86 -14.13 312 23 CYS A 180 ? ? 63.46 -64.90 313 23 CYS A 181 ? ? -173.03 55.21 314 23 PRO A 183 ? ? -80.17 -82.12 315 23 ASN A 185 ? ? -172.01 24.42 316 24 CYS A 4 ? ? -47.09 151.03 317 24 GLU A 20 ? ? -149.92 -132.02 318 24 TRP A 21 ? ? 54.17 105.01 319 24 LEU A 44 ? ? -121.67 -143.42 320 24 PHE A 63 ? ? -101.41 67.44 321 24 ASP A 64 ? ? -35.55 159.98 322 24 ALA A 83 ? ? -178.66 -57.37 323 24 ILE A 86 ? ? -45.24 174.14 324 24 HIS A 88 ? ? -161.59 13.59 325 24 ASN A 121 ? ? 81.09 -52.24 326 24 HIS A 122 ? ? 149.99 -18.19 327 24 HIS A 175 ? ? -125.97 -93.33 328 24 VAL A 176 ? ? -175.21 140.35 329 24 CYS A 180 ? ? 55.49 -77.20 330 24 CYS A 181 ? ? -156.04 50.20 331 25 CYS A 4 ? ? -35.29 126.82 332 25 GLN A 9 ? ? -63.33 65.14 333 25 ASP A 10 ? ? -159.42 88.61 334 25 GLU A 20 ? ? -154.24 -120.11 335 25 TRP A 21 ? ? 53.67 103.45 336 25 ASP A 64 ? ? -38.78 163.98 337 25 ALA A 83 ? ? -115.70 -84.52 338 25 ILE A 86 ? ? -57.80 -145.63 339 25 ARG A 89 ? ? 54.94 -80.99 340 25 HIS A 175 ? ? -118.31 -93.29 341 25 VAL A 176 ? ? -175.60 134.53 342 25 VAL A 177 ? ? -48.01 -11.34 343 25 ASN A 185 ? ? -159.54 21.56 # _pdbx_nmr_ensemble.entry_id 1NKU _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.conformer_selection_criteria ;structures with acceptable covalent geometry, structures with favorable non-bond energy, structures with the least restraint violations, structures with the lowest energy ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1NKU _pdbx_nmr_representative.conformer_id 17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.5-1mM 3-methyladenine DNA glycosylase I (TAG), 10mM phosphate buffer, pH 6.6, 100mM NaCl, 3mM DTT, 0.34 mM NaN3' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.entry_id 1NKU _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal CNS 1.1 'structure solution' ? 1 X-PLOR 'NIH 2.2' refinement 'G.M Clore' 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DMX 500 2 ? Bruker DMX 600 3 ? Bruker DMX 750 4 ? Varian UNITYPLUS 600 # _atom_sites.entry_id 1NKU _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_