data_1OR5 # _entry.id 1OR5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1OR5 pdb_00001or5 10.2210/pdb1or5/pdb RCSB RCSB018586 ? ? WWPDB D_1000018586 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1OR5 _pdbx_database_status.recvd_initial_deposition_date 2003-03-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, Q.' 1 'Khosla, C.' 2 'Puglisi, J.' 3 'Liu, C.W.' 4 # _citation.id primary _citation.title 'Solution Structure and Backbone Dynamics of the Holo Form of the Frenolicin Acyl Carrier Protein' _citation.journal_abbrev Biochemistry _citation.journal_volume 42 _citation.page_first 4648 _citation.page_last 4657 _citation.year 2003 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12705828 _citation.pdbx_database_id_DOI 10.1021/bi0274120 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, Q.' 1 ? primary 'Khosla, C.' 2 ? primary 'Puglisi, J.D.' 3 ? primary 'Liu, C.W.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'acyl carrier protein' _entity.formula_weight 8799.721 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FREN N, FREN ACP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTP ATA ; _entity_poly.pdbx_seq_one_letter_code_can ;MSALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTP ATA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ALA n 1 4 LEU n 1 5 THR n 1 6 VAL n 1 7 ASP n 1 8 ASP n 1 9 LEU n 1 10 LYS n 1 11 LYS n 1 12 LEU n 1 13 LEU n 1 14 ALA n 1 15 GLU n 1 16 THR n 1 17 ALA n 1 18 GLY n 1 19 GLU n 1 20 ASP n 1 21 ASP n 1 22 SER n 1 23 VAL n 1 24 ASP n 1 25 LEU n 1 26 ALA n 1 27 GLY n 1 28 GLU n 1 29 LEU n 1 30 ASP n 1 31 THR n 1 32 PRO n 1 33 PHE n 1 34 VAL n 1 35 ASP n 1 36 LEU n 1 37 GLY n 1 38 TYR n 1 39 ASP n 1 40 SER n 1 41 LEU n 1 42 ALA n 1 43 LEU n 1 44 LEU n 1 45 GLU n 1 46 THR n 1 47 ALA n 1 48 ALA n 1 49 VAL n 1 50 LEU n 1 51 GLN n 1 52 GLN n 1 53 ARG n 1 54 TYR n 1 55 GLY n 1 56 ILE n 1 57 ALA n 1 58 LEU n 1 59 THR n 1 60 ASP n 1 61 GLU n 1 62 THR n 1 63 VAL n 1 64 GLY n 1 65 ARG n 1 66 LEU n 1 67 GLY n 1 68 THR n 1 69 PRO n 1 70 ARG n 1 71 GLU n 1 72 LEU n 1 73 LEU n 1 74 ASP n 1 75 GLU n 1 76 VAL n 1 77 ASN n 1 78 THR n 1 79 THR n 1 80 PRO n 1 81 ALA n 1 82 THR n 1 83 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptomyces _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces roseofulvus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33902 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET21C-FRENACP _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q54996_9ACTO _struct_ref.pdbx_db_accession Q54996 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSALTVDDLKKLLAETAGEDDSVDLAGELDTPFVDLGYDSLALLETAAVLQQRYGIALTDETVGRLGTPRELLDEVNTTP ATA ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1OR5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q54996 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 82 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 HNCACB 2 1 1 CCONH 3 1 1 HCCONH 4 1 1 HCCH-TOCSY 5 1 1 HCCH-COSY 6 1 1 HNHA 7 1 1 13C/15N-HSQC-NOESY 8 1 1 15N-HSQC-NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288.00 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '30 mM PHOSPHATE' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.7 TO 1.2 MM 15N,13C 30 MM SODIUM PHOSPHATE PH 5.5; 2 MM DTT; 0.5% NAN3' _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 500 ? 2 INOVA Varian 800 ? # _pdbx_nmr_refine.entry_id 1OR5 _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1OR5 _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' # _pdbx_nmr_ensemble.entry_id 1OR5 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement DYANA 1.5 ? 1 'structure solution' NMRPipe ? ? 2 'structure solution' Sparky ? ? 3 # _exptl.entry_id 1OR5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol ? _exptl_crystal.density_Matthews ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1OR5 _struct.title 'SOLUTION STRUCTURE OF THE HOLO-FORM OF THE FRENOLICIN ACYL CARRIER PROTEIN, MINIMIZED MEAN STRUCTURE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1OR5 _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text 'ACYL CARRIER PROTEIN, ACP, BIOSYNTHESIS, FRENOLICIN, HOLO, POLYKETIDE SYNTHASE, PKS, BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 5 ? ALA A 17 ? THR A 4 ALA A 16 1 ? 13 HELX_P HELX_P2 2 ASP A 24 ? GLU A 28 ? ASP A 23 GLU A 27 5 ? 5 HELX_P HELX_P3 3 PRO A 32 ? GLY A 37 ? PRO A 31 GLY A 36 1 ? 6 HELX_P HELX_P4 4 ASP A 39 ? GLN A 52 ? ASP A 38 GLN A 51 1 ? 14 HELX_P HELX_P5 5 THR A 59 ? LEU A 66 ? THR A 58 LEU A 65 1 ? 8 HELX_P HELX_P6 6 PRO A 69 ? ASN A 77 ? PRO A 68 ASN A 76 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1OR5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1OR5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 ALA 3 2 2 ALA ALA A . n A 1 4 LEU 4 3 3 LEU LEU A . n A 1 5 THR 5 4 4 THR THR A . n A 1 6 VAL 6 5 5 VAL VAL A . n A 1 7 ASP 7 6 6 ASP ASP A . n A 1 8 ASP 8 7 7 ASP ASP A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 LYS 10 9 9 LYS LYS A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 LEU 12 11 11 LEU LEU A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ALA 14 13 13 ALA ALA A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 THR 16 15 15 THR THR A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 GLY 18 17 17 GLY GLY A . n A 1 19 GLU 19 18 18 GLU GLU A . n A 1 20 ASP 20 19 19 ASP ASP A . n A 1 21 ASP 21 20 20 ASP ASP A . n A 1 22 SER 22 21 21 SER SER A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 ASP 24 23 23 ASP ASP A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 ALA 26 25 25 ALA ALA A . n A 1 27 GLY 27 26 26 GLY GLY A . n A 1 28 GLU 28 27 27 GLU GLU A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 ASP 30 29 29 ASP ASP A . n A 1 31 THR 31 30 30 THR THR A . n A 1 32 PRO 32 31 31 PRO PRO A . n A 1 33 PHE 33 32 32 PHE PHE A . n A 1 34 VAL 34 33 33 VAL VAL A . n A 1 35 ASP 35 34 34 ASP ASP A . n A 1 36 LEU 36 35 35 LEU LEU A . n A 1 37 GLY 37 36 36 GLY GLY A . n A 1 38 TYR 38 37 37 TYR TYR A . n A 1 39 ASP 39 38 38 ASP ASP A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 LEU 41 40 40 LEU LEU A . n A 1 42 ALA 42 41 41 ALA ALA A . n A 1 43 LEU 43 42 42 LEU LEU A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 THR 46 45 45 THR THR A . n A 1 47 ALA 47 46 46 ALA ALA A . n A 1 48 ALA 48 47 47 ALA ALA A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 LEU 50 49 49 LEU LEU A . n A 1 51 GLN 51 50 50 GLN GLN A . n A 1 52 GLN 52 51 51 GLN GLN A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 TYR 54 53 53 TYR TYR A . n A 1 55 GLY 55 54 54 GLY GLY A . n A 1 56 ILE 56 55 55 ILE ILE A . n A 1 57 ALA 57 56 56 ALA ALA A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 ASP 60 59 59 ASP ASP A . n A 1 61 GLU 61 60 60 GLU GLU A . n A 1 62 THR 62 61 61 THR THR A . n A 1 63 VAL 63 62 62 VAL VAL A . n A 1 64 GLY 64 63 63 GLY GLY A . n A 1 65 ARG 65 64 64 ARG ARG A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 GLY 67 66 66 GLY GLY A . n A 1 68 THR 68 67 67 THR THR A . n A 1 69 PRO 69 68 68 PRO PRO A . n A 1 70 ARG 70 69 69 ARG ARG A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LEU 72 71 71 LEU LEU A . n A 1 73 LEU 73 72 72 LEU LEU A . n A 1 74 ASP 74 73 73 ASP ASP A . n A 1 75 GLU 75 74 74 GLU GLU A . n A 1 76 VAL 76 75 75 VAL VAL A . n A 1 77 ASN 77 76 76 ASN ASN A . n A 1 78 THR 78 77 77 THR THR A . n A 1 79 THR 79 78 78 THR THR A . n A 1 80 PRO 80 79 79 PRO PRO A . n A 1 81 ALA 81 80 80 ALA ALA A . n A 1 82 THR 82 81 81 THR THR A . n A 1 83 ALA 83 82 82 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-07-01 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 12 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 16 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.54 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 16 ? ? -58.69 -74.62 2 1 ASP A 19 ? ? -102.29 61.26 3 1 ASP A 20 ? ? -145.48 -46.94 4 1 SER A 21 ? ? -161.16 55.23 5 1 VAL A 22 ? ? -96.10 55.33 6 1 GLU A 27 ? ? 171.79 85.26 7 1 LEU A 35 ? ? -59.90 -89.41 8 1 TYR A 37 ? ? -35.62 140.59 9 1 TYR A 53 ? ? -93.81 -78.02 10 1 GLU A 60 ? ? -38.87 -71.60 11 1 THR A 77 ? ? -132.20 -61.83 12 1 THR A 78 ? ? -43.39 102.29 13 1 ALA A 80 ? ? -154.53 62.97 14 1 THR A 81 ? ? -143.79 -60.35 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 0 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 #