data_1P0R # _entry.id 1P0R # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P0R pdb_00001p0r 10.2210/pdb1p0r/pdb RCSB RCSB018874 ? ? WWPDB D_1000018874 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P0R _pdbx_database_status.recvd_initial_deposition_date 2003-04-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'McNally, T.' 1 'Huang, Q.' 2 'Janis, R.S.' 3 'Liu, Z.' 4 'Olejniczak, E.T.' 5 'Reilly, R.M.' 6 # _citation.id primary _citation.title 'Structural analysis of UBL5, a novel ubiquitin-like modifier' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 12 _citation.page_first 1562 _citation.page_last 1566 _citation.year 2003 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12824502 _citation.pdbx_database_id_DOI 10.1110/ps.0382803 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McNally, T.' 1 ? primary 'Huang, Q.' 2 ? primary 'Janis, R.S.' 3 ? primary 'Liu, Z.' 4 ? primary 'Olejniczak, E.T.' 5 ? primary 'Reilly, R.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ubiquitin-like 5' _entity.formula_weight 10732.312 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ILE n 1 23 GLU n 1 24 VAL n 1 25 VAL n 1 26 CYS n 1 27 ASN n 1 28 ASP n 1 29 ARG n 1 30 LEU n 1 31 GLY n 1 32 LYS n 1 33 LYS n 1 34 VAL n 1 35 ARG n 1 36 VAL n 1 37 LYS n 1 38 CYS n 1 39 ASN n 1 40 THR n 1 41 ASP n 1 42 ASP n 1 43 THR n 1 44 ILE n 1 45 GLY n 1 46 ASP n 1 47 LEU n 1 48 LYS n 1 49 LYS n 1 50 LEU n 1 51 ILE n 1 52 ALA n 1 53 ALA n 1 54 GLN n 1 55 THR n 1 56 GLY n 1 57 THR n 1 58 ARG n 1 59 TRP n 1 60 ASN n 1 61 LYS n 1 62 ILE n 1 63 VAL n 1 64 LEU n 1 65 LYS n 1 66 LYS n 1 67 TRP n 1 68 TYR n 1 69 THR n 1 70 ILE n 1 71 PHE n 1 72 LYS n 1 73 ASP n 1 74 HIS n 1 75 VAL n 1 76 SER n 1 77 LEU n 1 78 GLY n 1 79 ASP n 1 80 TYR n 1 81 GLU n 1 82 ILE n 1 83 HIS n 1 84 ASP n 1 85 GLY n 1 86 MET n 1 87 ASN n 1 88 LEU n 1 89 GLU n 1 90 LEU n 1 91 TYR n 1 92 TYR n 1 93 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'bl21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBL5_HUMAN _struct_ref.pdbx_db_accession Q9BZL1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P0R _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 93 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BZL1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1P0R MET A 1 ? UNP Q9BZL1 ? ? 'expression tag' -19 1 1 1P0R GLY A 2 ? UNP Q9BZL1 ? ? 'expression tag' -18 2 1 1P0R SER A 3 ? UNP Q9BZL1 ? ? 'expression tag' -17 3 1 1P0R SER A 4 ? UNP Q9BZL1 ? ? 'expression tag' -16 4 1 1P0R HIS A 5 ? UNP Q9BZL1 ? ? 'expression tag' -15 5 1 1P0R HIS A 6 ? UNP Q9BZL1 ? ? 'expression tag' -14 6 1 1P0R HIS A 7 ? UNP Q9BZL1 ? ? 'expression tag' -13 7 1 1P0R HIS A 8 ? UNP Q9BZL1 ? ? 'expression tag' -12 8 1 1P0R HIS A 9 ? UNP Q9BZL1 ? ? 'expression tag' -11 9 1 1P0R HIS A 10 ? UNP Q9BZL1 ? ? 'expression tag' -10 10 1 1P0R SER A 11 ? UNP Q9BZL1 ? ? 'expression tag' -9 11 1 1P0R SER A 12 ? UNP Q9BZL1 ? ? 'expression tag' -8 12 1 1P0R GLY A 13 ? UNP Q9BZL1 ? ? 'expression tag' -7 13 1 1P0R LEU A 14 ? UNP Q9BZL1 ? ? 'expression tag' -6 14 1 1P0R VAL A 15 ? UNP Q9BZL1 ? ? 'expression tag' -5 15 1 1P0R PRO A 16 ? UNP Q9BZL1 ? ? 'expression tag' -4 16 1 1P0R ARG A 17 ? UNP Q9BZL1 ? ? 'expression tag' -3 17 1 1P0R GLY A 18 ? UNP Q9BZL1 ? ? 'expression tag' -2 18 1 1P0R SER A 19 ? UNP Q9BZL1 ? ? 'expression tag' -1 19 1 1P0R HIS A 20 ? UNP Q9BZL1 ? ? 'expression tag' 0 20 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 5.7 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM sodium phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '.5mM UBL5 U-15N,13C 50mM sodium phosphate (pH 5.7), 2mM Dtt' '90% H2O/10% D2O' 2 '1.0mM UBL5 U-15N,13C 50mM sodium phosphate (pH 5.7), 2mM Dtt' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1P0R _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Based on 952 NMR-derived distance and torsion angle restraints.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1P0R _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1P0R _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_software.name CNX _pdbx_nmr_software.version 2000 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors 'Brunger, A.T.' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1P0R _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1P0R _struct.title 'Solution Structure of UBL5 a human Ubiquitin-Like Protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1P0R _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'Ubiquitin-like fold, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 43 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 53 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 23 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 33 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 32 ? CYS A 38 ? LYS A 12 CYS A 18 A 2 ILE A 22 ? ASP A 28 ? ILE A 2 ASP A 8 A 3 MET A 86 ? TYR A 91 ? MET A 66 TYR A 71 A 4 VAL A 63 ? LYS A 65 ? VAL A 43 LYS A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 32 ? O LYS A 12 N ASP A 28 ? N ASP A 8 A 2 3 N VAL A 25 ? N VAL A 5 O MET A 86 ? O MET A 66 A 3 4 O TYR A 91 ? O TYR A 71 N VAL A 63 ? N VAL A 43 # _database_PDB_matrix.entry_id 1P0R _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1P0R _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 1 MET MET A . n A 1 22 ILE 22 2 2 ILE ILE A . n A 1 23 GLU 23 3 3 GLU GLU A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 CYS 26 6 6 CYS CYS A . n A 1 27 ASN 27 7 7 ASN ASN A . n A 1 28 ASP 28 8 8 ASP ASP A . n A 1 29 ARG 29 9 9 ARG ARG A . n A 1 30 LEU 30 10 10 LEU LEU A . n A 1 31 GLY 31 11 11 GLY GLY A . n A 1 32 LYS 32 12 12 LYS LYS A . n A 1 33 LYS 33 13 13 LYS LYS A . n A 1 34 VAL 34 14 14 VAL VAL A . n A 1 35 ARG 35 15 15 ARG ARG A . n A 1 36 VAL 36 16 16 VAL VAL A . n A 1 37 LYS 37 17 17 LYS LYS A . n A 1 38 CYS 38 18 18 CYS CYS A . n A 1 39 ASN 39 19 19 ASN ASN A . n A 1 40 THR 40 20 20 THR THR A . n A 1 41 ASP 41 21 21 ASP ASP A . n A 1 42 ASP 42 22 22 ASP ASP A . n A 1 43 THR 43 23 23 THR THR A . n A 1 44 ILE 44 24 24 ILE ILE A . n A 1 45 GLY 45 25 25 GLY GLY A . n A 1 46 ASP 46 26 26 ASP ASP A . n A 1 47 LEU 47 27 27 LEU LEU A . n A 1 48 LYS 48 28 28 LYS LYS A . n A 1 49 LYS 49 29 29 LYS LYS A . n A 1 50 LEU 50 30 30 LEU LEU A . n A 1 51 ILE 51 31 31 ILE ILE A . n A 1 52 ALA 52 32 32 ALA ALA A . n A 1 53 ALA 53 33 33 ALA ALA A . n A 1 54 GLN 54 34 34 GLN GLN A . n A 1 55 THR 55 35 35 THR THR A . n A 1 56 GLY 56 36 36 GLY GLY A . n A 1 57 THR 57 37 37 THR THR A . n A 1 58 ARG 58 38 38 ARG ARG A . n A 1 59 TRP 59 39 39 TRP TRP A . n A 1 60 ASN 60 40 40 ASN ASN A . n A 1 61 LYS 61 41 41 LYS LYS A . n A 1 62 ILE 62 42 42 ILE ILE A . n A 1 63 VAL 63 43 43 VAL VAL A . n A 1 64 LEU 64 44 44 LEU LEU A . n A 1 65 LYS 65 45 45 LYS LYS A . n A 1 66 LYS 66 46 46 LYS LYS A . n A 1 67 TRP 67 47 47 TRP TRP A . n A 1 68 TYR 68 48 48 TYR TYR A . n A 1 69 THR 69 49 49 THR THR A . n A 1 70 ILE 70 50 50 ILE ILE A . n A 1 71 PHE 71 51 51 PHE PHE A . n A 1 72 LYS 72 52 52 LYS LYS A . n A 1 73 ASP 73 53 53 ASP ASP A . n A 1 74 HIS 74 54 54 HIS HIS A . n A 1 75 VAL 75 55 55 VAL VAL A . n A 1 76 SER 76 56 56 SER SER A . n A 1 77 LEU 77 57 57 LEU LEU A . n A 1 78 GLY 78 58 58 GLY GLY A . n A 1 79 ASP 79 59 59 ASP ASP A . n A 1 80 TYR 80 60 60 TYR TYR A . n A 1 81 GLU 81 61 61 GLU GLU A . n A 1 82 ILE 82 62 62 ILE ILE A . n A 1 83 HIS 83 63 63 HIS HIS A . n A 1 84 ASP 84 64 64 ASP ASP A . n A 1 85 GLY 85 65 65 GLY GLY A . n A 1 86 MET 86 66 66 MET MET A . n A 1 87 ASN 87 67 67 ASN ASN A . n A 1 88 LEU 88 68 68 LEU LEU A . n A 1 89 GLU 89 69 69 GLU GLU A . n A 1 90 LEU 90 70 70 LEU LEU A . n A 1 91 TYR 91 71 71 TYR TYR A . n A 1 92 TYR 92 72 72 TYR TYR A . n A 1 93 GLN 93 73 73 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-28 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 18 ? ? -145.96 -149.45 2 1 ALA A 33 ? ? -95.11 42.19 3 1 GLN A 34 ? ? -151.91 -57.56 4 1 ARG A 38 ? ? 63.42 176.71 5 1 ASN A 40 ? ? -120.96 -58.28 6 1 TRP A 47 ? ? 74.82 -64.40 7 1 TYR A 48 ? ? 171.94 67.09 8 1 SER A 56 ? ? -154.37 61.30 9 1 GLU A 61 ? ? 51.70 84.45 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 #