data_1P6U # _entry.id 1P6U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1P6U pdb_00001p6u 10.2210/pdb1p6u/pdb RCSB RCSB019080 ? ? WWPDB D_1000019080 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-11-04 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 5 'Structure model' 1 4 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1P6U _pdbx_database_status.recvd_initial_deposition_date 2003-04-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1P6Q 'NMR STRUCTURE OF THE RESPONSE REGULATOR CHEY2 FROM SINORHIZOBIUM MELILOTI' unspecified TargetDB 1 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Riepl, H.' 1 'Scharf, B.' 2 'Maurer, T.' 3 'Schmitt, R.' 4 'Kalbitzer, H.R.' 5 'Structural Proteomics in Europe (SPINE)' 6 # _citation.id primary _citation.title 'Solution Structures of the Inactive and BeF(3)-activated Response Regulator CheY2' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 338 _citation.page_first 287 _citation.page_last 297 _citation.year 2004 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15066432 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2004.02.054 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Riepl, H.' 1 ? primary 'Scharf, B.' 2 ? primary 'Schmitt, R.' 3 ? primary 'Kalbitzer, H.R.' 4 ? primary 'Maurer, T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description CheY2 _entity.formula_weight 13725.188 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATK KAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATK KAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ALA n 1 5 GLU n 1 6 LYS n 1 7 ILE n 1 8 LYS n 1 9 VAL n 1 10 LEU n 1 11 ILE n 1 12 VAL n 1 13 ASP n 1 14 ASP n 1 15 GLN n 1 16 VAL n 1 17 THR n 1 18 SER n 1 19 ARG n 1 20 LEU n 1 21 LEU n 1 22 LEU n 1 23 GLY n 1 24 ASP n 1 25 ALA n 1 26 LEU n 1 27 GLN n 1 28 GLN n 1 29 LEU n 1 30 GLY n 1 31 PHE n 1 32 LYS n 1 33 GLN n 1 34 ILE n 1 35 THR n 1 36 ALA n 1 37 ALA n 1 38 GLY n 1 39 ASP n 1 40 GLY n 1 41 GLU n 1 42 GLN n 1 43 GLY n 1 44 MET n 1 45 LYS n 1 46 ILE n 1 47 MET n 1 48 ALA n 1 49 GLN n 1 50 ASN n 1 51 PRO n 1 52 HIS n 1 53 HIS n 1 54 LEU n 1 55 VAL n 1 56 ILE n 1 57 SER n 1 58 ASP n 1 59 PHE n 1 60 ASN n 1 61 MET n 1 62 PRO n 1 63 LYS n 1 64 MET n 1 65 ASP n 1 66 GLY n 1 67 LEU n 1 68 GLY n 1 69 LEU n 1 70 LEU n 1 71 GLN n 1 72 ALA n 1 73 VAL n 1 74 ARG n 1 75 ALA n 1 76 ASN n 1 77 PRO n 1 78 ALA n 1 79 THR n 1 80 LYS n 1 81 LYS n 1 82 ALA n 1 83 ALA n 1 84 PHE n 1 85 ILE n 1 86 ILE n 1 87 LEU n 1 88 THR n 1 89 ALA n 1 90 GLN n 1 91 GLY n 1 92 ASP n 1 93 ARG n 1 94 ALA n 1 95 LEU n 1 96 VAL n 1 97 GLN n 1 98 LYS n 1 99 ALA n 1 100 ALA n 1 101 ALA n 1 102 LEU n 1 103 GLY n 1 104 ALA n 1 105 ASN n 1 106 ASN n 1 107 VAL n 1 108 LEU n 1 109 ALA n 1 110 LYS n 1 111 PRO n 1 112 PHE n 1 113 THR n 1 114 ILE n 1 115 GLU n 1 116 LYS n 1 117 MET n 1 118 LYS n 1 119 ALA n 1 120 ALA n 1 121 ILE n 1 122 GLU n 1 123 ALA n 1 124 VAL n 1 125 PHE n 1 126 GLY n 1 127 ALA n 1 128 LEU n 1 129 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Sinorhizobium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sinorhizobium meliloti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 382 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ER2566 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pTYB1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 LYS 129 129 129 LYS LYS A . n # _cell.entry_id 1P6U _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1P6U _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1P6U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1P6U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1P6U _struct.title 'NMR structure of the BeF3-activated structure of the response regulator Chey2-Mg2+ from Sinorhizobium meliloti' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1P6U _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text ;CheY2 Beryllium fluoride, chemotaxis, response regulator, signal transduction, activation, Structural Proteomics in Europe, SPINE, Structural Genomics, SIGNALING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q52884_RHIME _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATK KAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q52884 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1P6U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 129 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q52884 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 129 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 129 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 3 ? ILE A 7 ? LEU A 3 ILE A 7 5 ? 5 HELX_P HELX_P2 2 GLN A 15 ? GLY A 30 ? GLN A 15 GLY A 30 1 ? 16 HELX_P HELX_P3 3 ASP A 39 ? ASN A 50 ? ASP A 39 ASN A 50 1 ? 12 HELX_P HELX_P4 4 ASP A 65 ? ASN A 76 ? ASP A 65 ASN A 76 1 ? 12 HELX_P HELX_P5 5 ASN A 76 ? LYS A 81 ? ASN A 76 LYS A 81 1 ? 6 HELX_P HELX_P6 6 ASP A 92 ? ALA A 104 ? ASP A 92 ALA A 104 1 ? 13 HELX_P HELX_P7 7 THR A 113 ? PHE A 125 ? THR A 113 PHE A 125 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 34 ? ALA A 37 ? ILE A 34 ALA A 37 A 2 VAL A 9 ? VAL A 12 ? VAL A 9 VAL A 12 A 3 LEU A 54 ? ASP A 58 ? LEU A 54 ASP A 58 A 4 ALA A 83 ? LEU A 87 ? ALA A 83 LEU A 87 A 5 VAL A 107 ? LEU A 108 ? VAL A 107 LEU A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 35 ? O THR A 35 N ILE A 11 ? N ILE A 11 A 2 3 N LEU A 10 ? N LEU A 10 O ILE A 56 ? O ILE A 56 A 3 4 N SER A 57 ? N SER A 57 O ILE A 85 ? O ILE A 85 A 4 5 N PHE A 84 ? N PHE A 84 O LEU A 108 ? O LEU A 108 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 22 ? ? H A LEU 26 ? ? 1.47 2 1 O A ASP 65 ? ? H A LEU 69 ? ? 1.47 3 1 O A GLY 40 ? ? H A MET 44 ? ? 1.50 4 1 O A LYS 98 ? ? H A LEU 102 ? ? 1.50 5 1 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.51 6 1 OD2 A ASP 58 ? ? HD21 A ASN 60 ? ? 1.59 7 1 O A LYS 116 ? ? H A ALA 120 ? ? 1.60 8 2 O A LEU 22 ? ? H A LEU 26 ? ? 1.47 9 2 O A ASP 65 ? ? H A LEU 69 ? ? 1.48 10 2 O A LYS 98 ? ? H A LEU 102 ? ? 1.50 11 2 O A GLY 40 ? ? H A MET 44 ? ? 1.52 12 2 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.54 13 2 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 14 3 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 15 3 O A ASP 65 ? ? H A LEU 69 ? ? 1.49 16 3 O A GLY 40 ? ? H A MET 44 ? ? 1.49 17 3 O A ALA 4 ? ? H A ILE 7 ? ? 1.50 18 3 O A LYS 98 ? ? H A LEU 102 ? ? 1.54 19 3 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 20 3 O A THR 79 ? ? H A ALA 82 ? ? 1.60 21 4 O A ALA 4 ? ? H A ILE 7 ? ? 1.45 22 4 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 23 4 O A ASP 65 ? ? H A LEU 69 ? ? 1.49 24 4 O A GLY 40 ? ? H A MET 44 ? ? 1.52 25 4 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.53 26 4 O A LYS 98 ? ? H A LEU 102 ? ? 1.54 27 4 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 28 4 H A PHE 59 ? ? O A LEU 87 ? ? 1.59 29 5 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.43 30 5 O A LEU 22 ? ? H A LEU 26 ? ? 1.47 31 5 O A GLY 40 ? ? H A MET 44 ? ? 1.47 32 5 O A ASP 65 ? ? H A LEU 69 ? ? 1.49 33 5 O A ALA 4 ? ? H A ILE 7 ? ? 1.52 34 5 HD22 A ASN 106 ? ? O A ALA 127 ? ? 1.54 35 5 OD2 A ASP 58 ? ? HD21 A ASN 60 ? ? 1.56 36 5 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 37 5 O A LYS 98 ? ? H A LEU 102 ? ? 1.60 38 6 O A LEU 22 ? ? H A LEU 26 ? ? 1.45 39 6 O A ASP 65 ? ? H A LEU 69 ? ? 1.49 40 6 O A GLY 40 ? ? H A MET 44 ? ? 1.51 41 6 O A LYS 98 ? ? H A LEU 102 ? ? 1.53 42 6 O A ASN 105 ? ? HD21 A ASN 106 ? ? 1.58 43 6 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 44 6 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 45 7 O A LEU 22 ? ? H A LEU 26 ? ? 1.42 46 7 O A ASP 65 ? ? H A LEU 69 ? ? 1.47 47 7 O A LYS 98 ? ? H A LEU 102 ? ? 1.48 48 7 O A GLY 40 ? ? H A MET 44 ? ? 1.49 49 7 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.51 50 7 OD2 A ASP 58 ? ? HD21 A ASN 60 ? ? 1.58 51 7 O A LYS 116 ? ? H A ALA 120 ? ? 1.60 52 8 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 53 8 O A ALA 4 ? ? H A ILE 7 ? ? 1.48 54 8 O A ASP 65 ? ? H A LEU 69 ? ? 1.50 55 8 O A GLY 40 ? ? H A MET 44 ? ? 1.50 56 8 O A LYS 98 ? ? H A LEU 102 ? ? 1.53 57 8 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.55 58 8 H A PHE 59 ? ? O A LEU 87 ? ? 1.57 59 8 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 60 8 O A ARG 19 ? ? H A GLY 23 ? ? 1.59 61 9 O A LEU 22 ? ? H A LEU 26 ? ? 1.45 62 9 O A ASP 65 ? ? H A LEU 69 ? ? 1.47 63 9 O A GLY 40 ? ? H A MET 44 ? ? 1.51 64 9 O A LYS 98 ? ? H A LEU 102 ? ? 1.51 65 9 OD2 A ASP 58 ? ? HD21 A ASN 60 ? ? 1.52 66 9 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.55 67 9 O A ASN 105 ? ? HD21 A ASN 106 ? ? 1.55 68 9 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 69 9 H A PHE 59 ? ? O A LEU 87 ? ? 1.59 70 9 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 71 10 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 72 10 O A ASP 65 ? ? H A LEU 69 ? ? 1.47 73 10 O A GLY 40 ? ? H A MET 44 ? ? 1.49 74 10 O A LYS 98 ? ? H A LEU 102 ? ? 1.50 75 10 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.53 76 10 O A ARG 19 ? ? H A GLY 23 ? ? 1.57 77 10 H A PHE 59 ? ? O A LEU 87 ? ? 1.59 78 11 O A LEU 22 ? ? H A LEU 26 ? ? 1.45 79 11 O A GLY 40 ? ? H A MET 44 ? ? 1.48 80 11 O A ASP 65 ? ? H A LEU 69 ? ? 1.48 81 11 O A LYS 98 ? ? H A LEU 102 ? ? 1.51 82 11 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.52 83 11 O A ARG 19 ? ? H A GLY 23 ? ? 1.59 84 12 O A LEU 22 ? ? H A LEU 26 ? ? 1.47 85 12 O A GLY 40 ? ? H A MET 44 ? ? 1.51 86 12 O A ASP 65 ? ? H A LEU 69 ? ? 1.52 87 12 O A LYS 98 ? ? H A LEU 102 ? ? 1.53 88 12 O A ALA 4 ? ? H A ILE 7 ? ? 1.55 89 12 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.57 90 12 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 91 12 H A PHE 59 ? ? O A LEU 87 ? ? 1.60 92 13 O A LEU 22 ? ? H A LEU 26 ? ? 1.45 93 13 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.46 94 13 O A ASP 65 ? ? H A LEU 69 ? ? 1.48 95 13 OD2 A ASP 58 ? ? HD21 A ASN 60 ? ? 1.49 96 13 O A GLY 40 ? ? H A MET 44 ? ? 1.50 97 13 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 98 13 O A LYS 98 ? ? H A LEU 102 ? ? 1.59 99 14 O A LEU 22 ? ? H A LEU 26 ? ? 1.45 100 14 O A ASP 65 ? ? H A LEU 69 ? ? 1.47 101 14 O A GLY 40 ? ? H A MET 44 ? ? 1.48 102 14 O A LYS 98 ? ? H A LEU 102 ? ? 1.52 103 14 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.55 104 14 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 105 14 O A LYS 116 ? ? H A ALA 120 ? ? 1.59 106 15 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 107 15 O A GLY 40 ? ? H A MET 44 ? ? 1.47 108 15 O A ASP 65 ? ? H A LEU 69 ? ? 1.48 109 15 O A LYS 98 ? ? H A LEU 102 ? ? 1.50 110 15 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.52 111 15 O A THR 79 ? ? H A ALA 82 ? ? 1.56 112 15 O A ARG 19 ? ? H A GLY 23 ? ? 1.58 113 15 O A LYS 116 ? ? H A ALA 120 ? ? 1.60 114 16 O A LEU 22 ? ? H A LEU 26 ? ? 1.46 115 16 O A ASP 65 ? ? H A LEU 69 ? ? 1.48 116 16 O A GLY 40 ? ? H A MET 44 ? ? 1.49 117 16 O A LYS 98 ? ? H A LEU 102 ? ? 1.49 118 16 H A ASP 14 ? ? OD2 A ASP 58 ? ? 1.53 119 16 O A ARG 19 ? ? H A GLY 23 ? ? 1.59 120 16 O A LYS 116 ? ? H A ALA 120 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 19 ? ? -63.94 -71.27 2 1 LEU A 20 ? ? -39.16 -31.91 3 1 ASP A 39 ? ? 178.72 168.36 4 1 GLN A 42 ? ? -37.54 -29.12 5 1 HIS A 53 ? ? -140.37 -40.34 6 1 ASN A 60 ? ? -43.71 174.47 7 1 MET A 61 ? ? -108.35 67.53 8 1 PRO A 62 ? ? -74.91 -159.33 9 1 ARG A 74 ? ? -37.66 -30.18 10 1 GLN A 90 ? ? -118.71 -86.78 11 1 ASN A 106 ? ? -165.72 115.36 12 1 PRO A 111 ? ? -75.03 -160.45 13 1 LEU A 128 ? ? -61.10 -71.11 14 2 LYS A 6 ? ? -81.94 -80.09 15 2 ARG A 19 ? ? -63.73 -71.13 16 2 ASP A 39 ? ? 177.03 168.26 17 2 GLN A 42 ? ? -37.64 -28.97 18 2 HIS A 53 ? ? -132.81 -39.03 19 2 ASN A 60 ? ? -45.77 176.33 20 2 MET A 61 ? ? -108.07 68.13 21 2 PRO A 62 ? ? -75.01 -159.54 22 2 ARG A 74 ? ? -37.83 -30.32 23 2 GLN A 90 ? ? -115.71 -87.54 24 2 ASN A 106 ? ? -164.95 115.44 25 2 PRO A 111 ? ? -75.06 -160.86 26 2 ALA A 127 ? ? -74.79 -167.78 27 2 LEU A 128 ? ? -85.87 -78.98 28 3 LYS A 6 ? ? -36.43 -36.50 29 3 ARG A 19 ? ? -64.53 -71.21 30 3 LEU A 20 ? ? -39.29 -31.86 31 3 ASP A 39 ? ? 178.32 168.06 32 3 GLN A 42 ? ? -38.10 -28.82 33 3 HIS A 53 ? ? -137.21 -38.30 34 3 ASN A 60 ? ? -42.21 172.94 35 3 MET A 61 ? ? -108.03 68.74 36 3 PRO A 62 ? ? -74.99 -159.38 37 3 LEU A 70 ? ? -58.24 -70.10 38 3 ARG A 74 ? ? -38.12 -30.15 39 3 GLN A 90 ? ? -123.21 -86.92 40 3 ASN A 106 ? ? -166.43 116.67 41 3 PRO A 111 ? ? -74.99 -160.10 42 3 LEU A 128 ? ? -63.57 -72.18 43 4 LYS A 6 ? ? -38.78 -36.89 44 4 ARG A 19 ? ? -63.75 -70.63 45 4 ASP A 39 ? ? 179.22 168.18 46 4 GLN A 42 ? ? -38.09 -28.41 47 4 HIS A 53 ? ? -141.13 -40.41 48 4 ASN A 60 ? ? -46.03 176.55 49 4 MET A 61 ? ? -108.40 68.55 50 4 PRO A 62 ? ? -75.10 -158.58 51 4 ARG A 74 ? ? -38.01 -29.95 52 4 GLN A 90 ? ? -116.94 -85.22 53 4 ASN A 106 ? ? -165.34 115.44 54 4 PRO A 111 ? ? -74.97 -160.74 55 5 ARG A 19 ? ? -64.01 -71.18 56 5 LEU A 20 ? ? -39.75 -30.73 57 5 ASP A 39 ? ? 178.58 168.45 58 5 GLN A 42 ? ? -38.15 -28.65 59 5 HIS A 53 ? ? -139.35 -42.23 60 5 ASN A 60 ? ? -41.38 172.77 61 5 MET A 61 ? ? -108.38 66.61 62 5 PRO A 62 ? ? -75.00 -159.15 63 5 LEU A 70 ? ? -57.95 -70.08 64 5 ARG A 74 ? ? -37.59 -30.41 65 5 GLN A 90 ? ? -120.63 -88.86 66 5 ASN A 106 ? ? -165.99 114.39 67 5 PRO A 111 ? ? -74.94 -160.54 68 6 ARG A 19 ? ? -64.53 -71.52 69 6 LEU A 20 ? ? -39.40 -31.61 70 6 ASP A 39 ? ? 178.86 167.97 71 6 GLN A 42 ? ? -39.12 -27.84 72 6 HIS A 53 ? ? -134.55 -37.22 73 6 ASN A 60 ? ? -40.56 170.85 74 6 MET A 61 ? ? -109.28 68.26 75 6 PRO A 62 ? ? -74.99 -160.15 76 6 ARG A 74 ? ? -38.22 -30.12 77 6 GLN A 90 ? ? -120.88 -86.93 78 6 ASN A 106 ? ? -165.02 115.24 79 6 PRO A 111 ? ? -74.99 -161.83 80 6 LEU A 128 ? ? -56.64 -70.10 81 7 LEU A 3 ? ? -109.40 -167.89 82 7 ARG A 19 ? ? -64.75 -72.11 83 7 LEU A 20 ? ? -38.56 -31.25 84 7 ASP A 39 ? ? 177.61 169.24 85 7 GLN A 42 ? ? -37.87 -29.14 86 7 HIS A 53 ? ? -137.01 -38.45 87 7 ASN A 60 ? ? -42.48 172.81 88 7 MET A 61 ? ? -108.58 67.56 89 7 PRO A 62 ? ? -74.98 -159.05 90 7 ARG A 74 ? ? -38.23 -30.25 91 7 GLN A 90 ? ? -122.99 -88.23 92 7 ASN A 106 ? ? -165.09 117.63 93 7 PRO A 111 ? ? -74.96 -160.40 94 8 LYS A 6 ? ? -35.92 -34.43 95 8 ARG A 19 ? ? -64.35 -71.33 96 8 LEU A 20 ? ? -39.66 -30.62 97 8 ASP A 39 ? ? 178.16 168.27 98 8 GLN A 42 ? ? -37.72 -28.95 99 8 HIS A 53 ? ? -141.14 -50.19 100 8 ASN A 60 ? ? -45.61 176.14 101 8 MET A 61 ? ? -108.41 68.48 102 8 PRO A 62 ? ? -75.01 -160.56 103 8 ARG A 74 ? ? -38.28 -29.75 104 8 GLN A 90 ? ? -115.82 -85.54 105 8 ASN A 106 ? ? -165.47 115.15 106 8 PRO A 111 ? ? -74.99 -161.37 107 9 ARG A 19 ? ? -64.46 -71.36 108 9 LEU A 20 ? ? -39.55 -31.23 109 9 ASP A 39 ? ? 177.77 168.65 110 9 GLN A 42 ? ? -37.64 -29.10 111 9 HIS A 53 ? ? -137.07 -51.10 112 9 ASN A 60 ? ? -45.08 176.40 113 9 MET A 61 ? ? -107.91 67.57 114 9 PRO A 62 ? ? -75.02 -159.57 115 9 ARG A 74 ? ? -37.76 -30.11 116 9 GLN A 90 ? ? -115.52 -86.67 117 9 ASN A 106 ? ? -165.40 116.06 118 9 PRO A 111 ? ? -75.01 -161.41 119 10 ARG A 19 ? ? -64.48 -71.22 120 10 LEU A 20 ? ? -39.07 -31.20 121 10 ASP A 39 ? ? 179.65 168.90 122 10 GLN A 42 ? ? -37.92 -28.78 123 10 HIS A 53 ? ? -132.01 -32.33 124 10 ASN A 60 ? ? -44.72 175.82 125 10 MET A 61 ? ? -108.74 67.77 126 10 PRO A 62 ? ? -74.98 -159.33 127 10 LEU A 70 ? ? -56.34 -70.03 128 10 ARG A 74 ? ? -38.26 -30.06 129 10 GLN A 90 ? ? -115.39 -85.28 130 10 ASN A 106 ? ? -164.74 116.15 131 10 PRO A 111 ? ? -75.00 -160.33 132 10 LEU A 128 ? ? -64.16 -75.68 133 11 GLU A 5 ? ? -29.71 -61.43 134 11 LYS A 6 ? ? 38.58 48.27 135 11 ARG A 19 ? ? -64.57 -71.77 136 11 LEU A 20 ? ? -38.90 -31.85 137 11 ASP A 39 ? ? 177.46 168.39 138 11 GLN A 42 ? ? -37.89 -28.96 139 11 HIS A 53 ? ? -142.33 -38.77 140 11 ASN A 60 ? ? -41.65 172.52 141 11 MET A 61 ? ? -108.64 67.33 142 11 PRO A 62 ? ? -75.02 -159.26 143 11 ARG A 74 ? ? -38.29 -30.16 144 11 GLN A 90 ? ? -124.63 -87.83 145 11 ASN A 106 ? ? -166.20 116.27 146 11 PRO A 111 ? ? -74.93 -160.26 147 12 LYS A 6 ? ? -39.46 -38.48 148 12 ARG A 19 ? ? -63.66 -71.08 149 12 LEU A 20 ? ? -39.98 -30.83 150 12 ASP A 39 ? ? 178.01 168.37 151 12 GLN A 42 ? ? -37.46 -29.08 152 12 HIS A 53 ? ? -140.81 -40.55 153 12 ASN A 60 ? ? -46.78 176.65 154 12 MET A 61 ? ? -108.83 69.38 155 12 PRO A 62 ? ? -75.13 -160.11 156 12 ARG A 74 ? ? -38.03 -30.25 157 12 GLN A 90 ? ? -114.14 -86.80 158 12 ASN A 106 ? ? -165.05 115.72 159 12 PRO A 111 ? ? -74.98 -160.22 160 13 ARG A 19 ? ? -64.37 -71.15 161 13 LEU A 20 ? ? -39.47 -31.29 162 13 ASP A 39 ? ? 177.64 168.36 163 13 GLN A 42 ? ? -37.80 -28.90 164 13 HIS A 53 ? ? -134.79 -38.96 165 13 ASN A 60 ? ? -41.85 173.10 166 13 MET A 61 ? ? -108.43 67.46 167 13 PRO A 62 ? ? -75.03 -159.91 168 13 ARG A 74 ? ? -37.64 -30.29 169 13 GLN A 90 ? ? -124.09 -89.01 170 13 ASN A 106 ? ? -166.27 115.89 171 13 PRO A 111 ? ? -74.98 -160.77 172 13 LEU A 128 ? ? -59.69 -70.90 173 14 GLU A 5 ? ? -29.34 -45.77 174 14 LYS A 6 ? ? -70.76 -72.52 175 14 ARG A 19 ? ? -64.26 -71.79 176 14 LEU A 20 ? ? -38.60 -31.92 177 14 ASP A 39 ? ? 177.74 168.28 178 14 GLN A 42 ? ? -38.21 -28.50 179 14 HIS A 53 ? ? -132.93 -38.53 180 14 ASN A 60 ? ? -41.61 171.99 181 14 MET A 61 ? ? -108.67 67.28 182 14 PRO A 62 ? ? -75.01 -159.28 183 14 ARG A 74 ? ? -37.56 -30.57 184 14 GLN A 90 ? ? -120.65 -86.13 185 14 ASN A 106 ? ? -165.50 116.02 186 14 PRO A 111 ? ? -75.03 -160.68 187 15 ARG A 19 ? ? -64.03 -71.56 188 15 LEU A 20 ? ? -38.98 -31.41 189 15 ASP A 39 ? ? 177.99 168.40 190 15 GLN A 42 ? ? -37.97 -28.99 191 15 HIS A 53 ? ? -136.02 -39.20 192 15 ASN A 60 ? ? -40.88 171.65 193 15 MET A 61 ? ? -108.16 68.26 194 15 PRO A 62 ? ? -75.02 -159.07 195 15 ARG A 74 ? ? -37.74 -30.09 196 15 GLN A 90 ? ? -123.11 -89.02 197 15 ASN A 106 ? ? -166.37 115.49 198 15 PRO A 111 ? ? -74.99 -160.46 199 15 LEU A 128 ? ? -61.07 -71.42 200 16 LYS A 6 ? ? 33.94 58.18 201 16 ARG A 19 ? ? -64.11 -71.17 202 16 ASP A 39 ? ? 177.19 168.78 203 16 GLN A 42 ? ? -37.70 -29.11 204 16 HIS A 53 ? ? -138.00 -37.95 205 16 ASN A 60 ? ? -44.97 175.46 206 16 MET A 61 ? ? -108.79 67.92 207 16 PRO A 62 ? ? -75.09 -159.46 208 16 ARG A 74 ? ? -37.96 -29.87 209 16 GLN A 90 ? ? -117.33 -86.16 210 16 ASN A 106 ? ? -165.88 115.47 211 16 PRO A 111 ? ? -75.03 -159.82 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Proteomics in Europe' _pdbx_SG_project.initial_of_center SPINE # _pdbx_nmr_ensemble.entry_id 1P6U _pdbx_nmr_ensemble.conformers_calculated_total_number 250 _pdbx_nmr_ensemble.conformers_submitted_total_number 16 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1P6U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM CheY2, 1MM TRIS-HCL, 5MM MGCL2, 5MM BECL2, 50MM NAF' _pdbx_nmr_sample_details.solvent_system '5mM MgCl2, 20mM Tris/HCl' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.83 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 3D_13C-separated_NOESY 3 1 1 3D_15N-separated_NOESY 7 1 1 HNCA 8 1 1 HNCO 9 1 1 'HN(CO)CA' 10 1 1 'CBCA(CO)CA' 11 1 1 'HBHA(CO)NH' 12 1 1 HCCH-TOCSY 13 1 1 'CC(CO)NH' # _pdbx_nmr_details.entry_id 1P6U _pdbx_nmr_details.text ;TOTAL NUMBER OF NOES USED FOR THE CALCULATION: 1595, NUMBER OF INTRA-RESIDUE NOES USED FOR THE CALCULATION: 815, NUMBER OF SEQUENTIAL NOES USED FOR THE CALCULATION: 406, NUMBER OF MEDIUM RANGE NOES USED FOR THE CALCULATION: 155, NUMBER OF LONG RANGE (I,J, J > I+4) NOES USED FOR THE CALCULATION: 219, NUMBER OF DIHEDRAL ANGLES RESTRAINTS USED FOR THE CALCULATION: 58, NUMBER OF HYDROGEN BOND RESTRAINTS USED FOR THE CALCULATION: 7, MINIMAL TARGET FUNCTION WAS 1.92, MEAN TARGET FUNCTION OF 16 STRUCTURES WAS 1.95 (+-0.2), THE NUMBER OF NOE VIOLATIONS > 0.02 NM WAS 5 (+-2), THE NUMBER OF NOE VIOLATIONS > 0.03 NM WAS 0, THE NUMBER OF DIHEDRAL ANGLES VIOLATIONS > 10 DEGREES WAS 0, RMSDS BACK BONE (6-124): 0.027 (+-0.007) NM, RMSDS ALL HEAVY ATOMS (6-124): 0.083 (+-0.013)NM ; # _pdbx_nmr_refine.entry_id 1P6U _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.5 collection Bruker 1 AURELIA 2.7.9 'data analysis' Bruker 2 DIANA 1.5 'structure solution' Guentert 3 DIANA 1.5 refinement Guentert 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 VAL N N N N 304 VAL CA C N S 305 VAL C C N N 306 VAL O O N N 307 VAL CB C N N 308 VAL CG1 C N N 309 VAL CG2 C N N 310 VAL OXT O N N 311 VAL H H N N 312 VAL H2 H N N 313 VAL HA H N N 314 VAL HB H N N 315 VAL HG11 H N N 316 VAL HG12 H N N 317 VAL HG13 H N N 318 VAL HG21 H N N 319 VAL HG22 H N N 320 VAL HG23 H N N 321 VAL HXT H N N 322 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 600 2 ? Bruker DRX 800 # _atom_sites.entry_id 1P6U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_