data_1PFH # _entry.id 1PFH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.287 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1PFH WWPDB D_1000175640 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PFH _pdbx_database_status.recvd_initial_deposition_date 1995-08-18 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Van Nuland, N.A.J.' 1 'Scheek, R.M.' 2 'Robillard, G.T.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;High-resolution structure of the phosphorylated form of the histidine-containing phosphocarrier protein HPr from Escherichia coli determined by restrained molecular dynamics from NMR-NOE data. ; J.Mol.Biol. 246 180 193 1995 JMOBAK UK 0022-2836 0070 ? 7853396 10.1006/jmbi.1994.0075 1 ;The High-Resolution Structure of the Histidine-Containing Phosphocarrier Protein Hpr from Escherichia Coli Determined by Restrained Molecular Dynamics from Nuclear Magnetic Resonance Nuclear Overhauser Effect Data ; J.Mol.Biol. 237 544 ? 1994 JMOBAK UK 0022-2836 0070 ? ? ? 2 'Active-Centre Torsion-Angle Strain Revealed in 1.6 Angstroms-Resolution Structure of Histidine-Containing Phosphocarrier Protein' Nature 361 94 ? 1993 NATUAS UK 0028-0836 0006 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'van Nuland, N.A.' 1 primary 'Boelens, R.' 2 primary 'Scheek, R.M.' 3 primary 'Robillard, G.T.' 4 1 'Van Nuland, N.A.J.' 5 1 'Hangyi, I.W.' 6 1 'Van Schaik, R.C.' 7 1 'Berendsen, H.J.C.' 8 1 'Van Gunsteren, W.F.' 9 1 'Scheek, R.M.' 10 1 'Robillard, G.T.' 11 2 'Jia, Z.' 12 2 'Vandonselaar, M.' 13 2 'Quail, J.W.' 14 2 'Delbaere, L.T.J.' 15 # _cell.entry_id 1PFH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PFH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description PHOSPHO-HPR _entity.formula_weight 9209.312 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'PH 7.5, 20 DEGREES C, 50 MM KPI BUFFER' # _entity_name_com.entity_id 1 _entity_name_com.name P-HPR # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MFQQEVTITAPNGL(HIP)TRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEH LVKLMAELE ; _entity_poly.pdbx_seq_one_letter_code_can ;MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL MAELE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 GLN n 1 4 GLN n 1 5 GLU n 1 6 VAL n 1 7 THR n 1 8 ILE n 1 9 THR n 1 10 ALA n 1 11 PRO n 1 12 ASN n 1 13 GLY n 1 14 LEU n 1 15 HIP n 1 16 THR n 1 17 ARG n 1 18 PRO n 1 19 ALA n 1 20 ALA n 1 21 GLN n 1 22 PHE n 1 23 VAL n 1 24 LYS n 1 25 GLU n 1 26 ALA n 1 27 LYS n 1 28 GLY n 1 29 PHE n 1 30 THR n 1 31 SER n 1 32 GLU n 1 33 ILE n 1 34 THR n 1 35 VAL n 1 36 THR n 1 37 SER n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 SER n 1 42 ALA n 1 43 SER n 1 44 ALA n 1 45 LYS n 1 46 SER n 1 47 LEU n 1 48 PHE n 1 49 LYS n 1 50 LEU n 1 51 GLN n 1 52 THR n 1 53 LEU n 1 54 GLY n 1 55 LEU n 1 56 THR n 1 57 GLN n 1 58 GLY n 1 59 THR n 1 60 VAL n 1 61 VAL n 1 62 THR n 1 63 ILE n 1 64 SER n 1 65 ALA n 1 66 GLU n 1 67 GLY n 1 68 GLU n 1 69 ASP n 1 70 GLU n 1 71 GLN n 1 72 LYS n 1 73 ALA n 1 74 VAL n 1 75 GLU n 1 76 HIS n 1 77 LEU n 1 78 VAL n 1 79 LYS n 1 80 LEU n 1 81 MET n 1 82 ALA n 1 83 GLU n 1 84 LEU n 1 85 GLU n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Escherichia coli' _entity_src_nat.pdbx_ncbi_taxonomy_id 562 _entity_src_nat.genus Escherichia _entity_src_nat.species ? _entity_src_nat.strain HB2154 _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTHP_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P0AA04 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL MAELE ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PFH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AA04 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIP 'L-peptide linking' n ND1-PHOSPHONOHISTIDINE ? 'C6 H11 N3 O5 P 1' 236.142 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_ensemble.entry_id 1PFH _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name GROMOS _pdbx_nmr_software.version ? _pdbx_nmr_software.authors 'VAN GUNSTEREN,BERENDSEN' _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1PFH _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1PFH _struct.title 'THE PHOSPHORYLATED FORM OF THE HISTIDINE-CONTAINING PHOSPHOCARRIER PROTEIN HPR' _struct.pdbx_descriptor 'PHOSPHO-HPR, PHOSPHONO GROUP' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PFH _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text 'PHOSPHOCARRIER PROTEIN, TRANSPORT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag Y _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 16 ? LYS A 27 ? THR A 16 LYS A 27 1 ? 12 HELX_P HELX_P2 2 SER A 46 ? THR A 52 ? SER A 46 THR A 52 1 ? 7 HELX_P HELX_P3 3 ASP A 69 ? LEU A 84 ? ASP A 69 LEU A 84 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 14 C ? ? ? 1_555 A HIP 15 N ? ? A LEU 14 A HIP 15 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A HIP 15 C ? ? ? 1_555 A THR 16 N ? ? A HIP 15 A THR 16 1_555 ? ? ? ? ? ? ? 1.331 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 2 ? THR A 7 ? PHE A 2 THR A 7 A 2 VAL A 60 ? ALA A 65 ? VAL A 60 ALA A 65 A 3 THR A 34 ? SER A 37 ? THR A 34 SER A 37 A 4 LYS A 40 ? SER A 43 ? LYS A 40 SER A 43 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 6 ? N VAL A 6 O VAL A 61 ? O VAL A 61 A 2 3 O THR A 62 ? O THR A 62 N THR A 36 ? N THR A 36 A 3 4 N VAL A 35 ? N VAL A 35 O ALA A 42 ? O ALA A 42 # _database_PDB_matrix.entry_id 1PFH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PFH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 HIP 15 15 15 HIP HIP A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 MET 81 81 81 MET MET A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id HIP _pdbx_struct_mod_residue.label_seq_id 15 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id HIP _pdbx_struct_mod_residue.auth_seq_id 15 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id HIS _pdbx_struct_mod_residue.details ND1-PHOSPHONOHISTIDINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1995-11-14 2 'Structure model' 1 1 2008-03-03 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_conf 5 4 'Structure model' struct_conf_type # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_database_status.process_site' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.59 2 2 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.59 3 3 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.57 4 5 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.58 5 8 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.55 6 9 O A THR 56 ? ? HG1 A THR 59 ? ? 1.53 7 9 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.58 8 10 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.52 9 11 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.56 10 12 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.54 11 13 O A THR 56 ? ? HG1 A THR 59 ? ? 1.55 12 14 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.50 13 15 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.58 14 17 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.51 15 20 OE2 A GLU 32 ? ? HG A SER 43 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIP A 15 ? ? 51.01 -121.43 2 1 ASN A 38 ? ? 37.94 64.44 3 1 LYS A 40 ? ? -68.51 88.69 4 1 SER A 43 ? ? -58.98 103.85 5 1 LEU A 47 ? ? -32.54 -73.35 6 1 ASP A 69 ? ? -83.56 31.59 7 2 HIP A 15 ? ? 49.57 -117.05 8 2 THR A 16 ? ? -100.20 -62.67 9 3 HIP A 15 ? ? 42.47 -124.17 10 3 THR A 52 ? ? -100.54 54.01 11 4 HIP A 15 ? ? 47.58 -115.84 12 4 ASN A 38 ? ? 39.94 51.31 13 4 THR A 52 ? ? -118.12 75.31 14 4 THR A 59 ? ? -30.79 113.19 15 4 THR A 62 ? ? -65.99 99.11 16 5 HIP A 15 ? ? 44.18 -109.09 17 5 THR A 16 ? ? -101.22 -68.05 18 5 THR A 52 ? ? -100.06 50.66 19 6 HIP A 15 ? ? 57.22 -124.74 20 6 LEU A 84 ? ? -76.85 -150.03 21 7 HIP A 15 ? ? 60.39 -125.89 22 8 HIP A 15 ? ? 42.20 -117.76 23 8 ASN A 38 ? ? 35.43 83.34 24 8 LEU A 55 ? ? -115.29 77.22 25 8 GLN A 57 ? ? -57.54 106.71 26 9 HIP A 15 ? ? 33.06 -124.92 27 9 ASN A 38 ? ? 43.26 70.13 28 9 GLU A 70 ? ? -46.05 -72.85 29 10 ALA A 10 ? ? -28.77 133.44 30 10 HIP A 15 ? ? 50.80 -123.33 31 10 ASN A 38 ? ? 43.94 71.25 32 10 LEU A 53 ? ? -149.58 -51.00 33 10 VAL A 61 ? ? -110.54 78.85 34 10 GLU A 83 ? ? -82.98 35.68 35 11 HIP A 15 ? ? 56.20 -128.08 36 11 ASN A 38 ? ? 47.57 75.00 37 11 THR A 52 ? ? -108.41 60.61 38 12 HIP A 15 ? ? 48.09 -119.57 39 12 ASN A 38 ? ? 33.77 90.25 40 12 THR A 52 ? ? -116.31 67.85 41 12 ASP A 69 ? ? -91.64 39.26 42 13 HIP A 15 ? ? 47.63 -123.02 43 14 HIP A 15 ? ? 48.49 -118.10 44 15 HIP A 15 ? ? 47.76 -114.46 45 15 ASN A 38 ? ? 43.63 72.43 46 15 THR A 59 ? ? -54.96 104.62 47 15 ASP A 69 ? ? -82.38 36.49 48 15 GLU A 70 ? ? -45.83 -72.53 49 16 HIP A 15 ? ? 48.67 -132.09 50 16 THR A 16 ? ? -99.28 -61.42 51 16 ASN A 38 ? ? 39.59 83.02 52 16 ILE A 63 ? ? -67.25 96.83 53 16 ASP A 69 ? ? -116.72 50.56 54 17 HIP A 15 ? ? 50.19 -122.48 55 17 ASN A 38 ? ? 40.63 73.47 56 17 GLN A 57 ? ? -52.20 109.15 57 17 ASP A 69 ? ? -88.71 39.03 58 18 HIP A 15 ? ? 44.56 -118.09 59 18 ASN A 38 ? ? 9.74 108.13 60 18 GLN A 57 ? ? -59.83 109.56 61 18 ASP A 69 ? ? -96.21 41.53 62 19 HIP A 15 ? ? 40.37 -112.64 63 19 THR A 16 ? ? -106.37 -62.04 64 19 ASN A 38 ? ? 25.66 64.08 65 19 ASP A 69 ? ? -79.09 33.64 66 19 GLU A 83 ? ? -77.16 38.74 67 20 HIP A 15 ? ? 55.80 -122.17 68 20 THR A 52 ? ? -112.21 61.12 69 20 LEU A 53 ? ? -122.12 -65.95 70 20 ASP A 69 ? ? -76.89 22.41 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 1 HIP A 15 ? ? 22.89 2 2 HIP A 15 ? ? 22.70 3 2 ASP A 69 ? ? -11.65 4 3 HIP A 15 ? ? 22.91 5 3 ASP A 69 ? ? -10.67 6 4 HIP A 15 ? ? 23.30 7 4 ASP A 69 ? ? -10.24 8 5 HIP A 15 ? ? 23.47 9 6 HIP A 15 ? ? 22.72 10 7 HIP A 15 ? ? 22.31 11 8 HIP A 15 ? ? 22.52 12 8 GLN A 71 ? ? -10.21 13 9 HIP A 15 ? ? 22.76 14 9 VAL A 60 ? ? 11.14 15 9 GLN A 71 ? ? -10.29 16 10 HIP A 15 ? ? 22.79 17 11 HIP A 15 ? ? 22.51 18 12 HIP A 15 ? ? 22.60 19 13 HIP A 15 ? ? 22.89 20 13 SER A 31 ? ? 10.13 21 13 ASP A 69 ? ? -11.26 22 13 GLN A 71 ? ? -10.04 23 14 MET A 1 ? ? 12.51 24 14 HIP A 15 ? ? 22.22 25 14 GLN A 71 ? ? -11.02 26 15 HIP A 15 ? ? 22.17 27 16 HIP A 15 ? ? 21.91 28 16 PHE A 48 ? ? -10.14 29 17 HIP A 15 ? ? 22.07 30 17 ASP A 69 ? ? -11.73 31 18 HIP A 15 ? ? 22.48 32 18 SER A 37 ? ? 10.66 33 19 HIP A 15 ? ? 22.60 34 19 ASP A 69 ? ? -10.50 35 19 LYS A 79 ? ? -11.37 36 20 HIP A 15 ? ? 22.52 37 20 LEU A 47 ? ? -10.80 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 PHE A 22 ? ? 0.095 'SIDE CHAIN' 2 3 PHE A 22 ? ? 0.081 'SIDE CHAIN' 3 4 PHE A 22 ? ? 0.091 'SIDE CHAIN' 4 9 PHE A 22 ? ? 0.074 'SIDE CHAIN' 5 11 PHE A 48 ? ? 0.078 'SIDE CHAIN' 6 12 PHE A 22 ? ? 0.090 'SIDE CHAIN' 7 13 PHE A 22 ? ? 0.092 'SIDE CHAIN' 8 20 PHE A 22 ? ? 0.101 'SIDE CHAIN' # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 7 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id HIP _pdbx_validate_chiral.auth_seq_id 15 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . #