data_1PGY # _entry.id 1PGY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PGY pdb_00001pgy 10.2210/pdb1pgy/pdb RCSB RCSB019315 ? ? WWPDB D_1000019315 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PGY _pdbx_database_status.recvd_initial_deposition_date 2003-05-28 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chim, N.' 1 'Gall, W.E.' 2 'Xiao, J.' 3 'Harris, M.P.' 4 'Graham, T.R.' 5 'Krezel, A.M.' 6 # _citation.id primary _citation.title 'Solution structure of the ubiquitin-binding domain in Swa2p from Saccharomyces cerevisiae.' _citation.journal_abbrev 'PROTEINS: STRUCT.,FUNCT.,GENET.' _citation.journal_volume 54 _citation.page_first 784 _citation.page_last 793 _citation.year 2004 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14997574 _citation.pdbx_database_id_DOI 10.1002/prot.10636 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chim, N.' 1 ? primary 'Gall, W.E.' 2 ? primary 'Xiao, J.' 3 ? primary 'Harris, M.P.' 4 ? primary 'Graham, T.R.' 5 ? primary 'Krezel, A.M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Swa2p _entity.formula_weight 5547.265 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Ubiquitin-associated (UBA) domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'auxilin-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE _entity_poly.pdbx_seq_one_letter_code_can ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 VAL n 1 4 ASP n 1 5 GLU n 1 6 VAL n 1 7 LYS n 1 8 ASP n 1 9 MET n 1 10 GLU n 1 11 ILE n 1 12 ALA n 1 13 ARG n 1 14 LEU n 1 15 MET n 1 16 SER n 1 17 LEU n 1 18 GLY n 1 19 LEU n 1 20 SER n 1 21 ILE n 1 22 GLU n 1 23 GLU n 1 24 ALA n 1 25 THR n 1 26 GLU n 1 27 PHE n 1 28 TYR n 1 29 GLU n 1 30 ASN n 1 31 ASP n 1 32 VAL n 1 33 THR n 1 34 TYR n 1 35 GLU n 1 36 ARG n 1 37 TYR n 1 38 LEU n 1 39 GLU n 1 40 ILE n 1 41 LEU n 1 42 LYS n 1 43 SER n 1 44 LYS n 1 45 GLN n 1 46 LYS n 1 47 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ;baker's yeast ; _entity_src_gen.gene_src_genus Saccharomyces _entity_src_gen.pdbx_gene_src_gene SWA2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET32-EkLIC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q06677_YEAST _struct_ref.pdbx_db_accession Q06677 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE _struct_ref.pdbx_align_begin 137 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PGY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 47 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06677 _struct_ref_seq.db_align_beg 137 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 47 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 2 1 1 '2D TOCSY' 3 1 1 DQF-COSY 4 4 1 '2D NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50mM phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM UBA domain; 50mM phosphate buffer' '90% H2O/10% D2O' 2 '1mM UBA domain U-15N; 50mM phosphate buffer' '90% H2O/10% D2O' 3 '1mM UBA domain U-15N,13C; 50mM phosphate buffer' '90% H2O/10% D2O' 4 '1mM UBA domain; 50mM phosphate buffer' '100% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 800 # _pdbx_nmr_refine.entry_id 1PGY _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details '373 NOE-derived distance constraints, 34 residual dipolar couplings' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1PGY _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PGY _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal XwinNMR 2.6 collection Bruker 1 CYANA 1.0.6 'structure solution' 'Guentert, P., Mumenthaler, C. & Wuethrich, K.' 2 Amber 7 refinement ;Case D.A., Pearlman D.A., Caldwell, J.W,. Cheatham T.E., Wang J., Ross W.S., Simmerling C., Darden T., Merz K.M., Stanton R.V., Cheng A., Vincent J.J., Crowley M., Tsui V., Gohlke H., Radmer R., Duan Y., Pitera J., Massova I., Seibel G.L., Singh U.C., Weiner P., Kollman P.A. ; 3 XEASY 1.3.x 'data analysis' 'Ch. Bartels, T.-H. Xia, M. Billeter, P. Guentert and K. Wuethrich' 4 Felix 2000 'data analysis' Accelrys 5 # _exptl.entry_id 1PGY _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1PGY _struct.title 'Solution structure of the UBA domain in Saccharomyces cerevisiae protein, Swa2p' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PGY _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'UBA, ubiquitin, Swa2, auxilin, ubiquitin-associated domain, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 3 ? GLY A 18 ? VAL A 3 GLY A 18 1 ? 16 HELX_P HELX_P2 2 ILE A 21 ? VAL A 32 ? ILE A 21 VAL A 32 1 ? 12 HELX_P HELX_P3 3 TYR A 34 ? LYS A 44 ? TYR A 34 LYS A 44 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1PGY _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PGY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ASN 30 30 30 ASN ASN A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-03-23 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-02-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 C A ASP 31 ? ? H A VAL 32 ? ? 1.56 2 7 C A ASP 31 ? ? H A VAL 32 ? ? 1.49 3 18 C A ASP 31 ? ? H A VAL 32 ? ? 1.54 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 11 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.31 120.30 3.01 0.50 N 2 16 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.32 120.30 3.02 0.50 N 3 19 NE A ARG 36 ? ? CZ A ARG 36 ? ? NH1 A ARG 36 ? ? 123.48 120.30 3.18 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 20 ? ? -65.74 -162.55 2 1 ILE A 21 ? ? -105.90 -98.94 3 1 VAL A 32 ? ? 157.30 -121.99 4 1 TYR A 34 ? ? 178.00 -81.87 5 1 LYS A 44 ? ? -62.99 -174.57 6 2 LEU A 2 ? ? 57.72 16.10 7 2 SER A 20 ? ? -60.46 -157.91 8 2 ILE A 21 ? ? -115.19 -94.18 9 2 ASP A 31 ? ? -61.79 -73.92 10 2 VAL A 32 ? ? -164.33 -78.44 11 2 THR A 33 ? ? -161.00 -58.26 12 2 TYR A 34 ? ? -179.72 -63.85 13 2 LYS A 44 ? ? -65.51 -173.82 14 3 LEU A 19 ? ? -120.46 -158.28 15 3 SER A 20 ? ? -89.38 -147.28 16 3 ILE A 21 ? ? -113.38 -95.27 17 3 ASP A 31 ? ? -96.70 -69.00 18 3 VAL A 32 ? ? 178.60 -122.26 19 3 THR A 33 ? ? -102.75 -74.08 20 3 TYR A 34 ? ? -163.47 -51.77 21 3 LYS A 44 ? ? -151.31 84.75 22 4 LEU A 2 ? ? 60.62 -71.06 23 4 ASP A 4 ? ? -154.87 84.33 24 4 LEU A 19 ? ? -102.60 -166.09 25 4 SER A 20 ? ? -79.66 -151.23 26 4 ILE A 21 ? ? -108.66 -83.67 27 4 VAL A 32 ? ? -175.67 -137.19 28 4 THR A 33 ? ? -108.59 -69.94 29 4 TYR A 34 ? ? -164.77 -55.86 30 5 LEU A 19 ? ? -136.02 -159.64 31 5 SER A 20 ? ? -93.03 -138.57 32 5 ILE A 21 ? ? -120.03 -97.65 33 5 ASP A 31 ? ? -101.27 -66.27 34 5 VAL A 32 ? ? -170.26 -102.13 35 5 THR A 33 ? ? -133.43 -50.49 36 5 TYR A 34 ? ? -175.99 -78.68 37 5 LYS A 44 ? ? 79.57 -63.02 38 5 GLN A 45 ? ? 39.17 31.06 39 6 LEU A 2 ? ? -166.34 -57.88 40 6 SER A 20 ? ? -58.94 -157.35 41 6 ILE A 21 ? ? -116.77 -97.55 42 6 ASP A 31 ? ? -78.57 -76.90 43 6 VAL A 32 ? ? -157.08 -95.57 44 6 THR A 33 ? ? -149.05 -39.08 45 6 TYR A 34 ? ? 171.05 -87.71 46 6 LYS A 44 ? ? -64.93 -176.90 47 7 SER A 20 ? ? -58.15 -161.20 48 7 ILE A 21 ? ? -107.73 -102.99 49 7 VAL A 32 ? ? 176.72 -132.16 50 7 TYR A 34 ? ? -177.53 -56.81 51 7 LYS A 46 ? ? 57.27 97.36 52 8 SER A 20 ? ? -63.38 -173.42 53 8 ILE A 21 ? ? -83.64 -116.24 54 8 VAL A 32 ? ? -167.42 -123.73 55 8 TYR A 34 ? ? 172.71 -78.99 56 8 LYS A 44 ? ? 65.76 92.15 57 8 GLN A 45 ? ? -148.00 20.27 58 8 LYS A 46 ? ? 65.80 156.04 59 9 SER A 20 ? ? -63.44 -159.99 60 9 ILE A 21 ? ? -123.55 -83.86 61 9 VAL A 32 ? ? -173.73 -72.67 62 9 THR A 33 ? ? -165.50 -58.06 63 9 TYR A 34 ? ? 178.15 -55.28 64 9 LYS A 44 ? ? 63.83 101.93 65 9 GLN A 45 ? ? -139.24 -55.82 66 10 ASP A 4 ? ? -63.22 12.90 67 10 SER A 20 ? ? -73.16 -153.76 68 10 ILE A 21 ? ? -103.41 -101.67 69 10 VAL A 32 ? ? 179.95 -102.14 70 10 THR A 33 ? ? -148.33 -72.31 71 10 TYR A 34 ? ? -151.68 -64.44 72 10 GLN A 45 ? ? 71.10 139.69 73 10 LYS A 46 ? ? 61.20 160.01 74 11 ASP A 4 ? ? -149.53 -22.80 75 11 SER A 20 ? ? -66.68 -163.43 76 11 ILE A 21 ? ? -106.06 -95.71 77 11 VAL A 32 ? ? 176.31 -121.71 78 11 THR A 33 ? ? -131.42 -34.33 79 11 TYR A 34 ? ? 170.03 -84.63 80 11 GLN A 45 ? ? -70.96 28.65 81 12 LEU A 2 ? ? 55.75 176.97 82 12 VAL A 3 ? ? 47.52 25.25 83 12 LEU A 19 ? ? -88.55 -148.43 84 12 SER A 20 ? ? -98.00 -123.70 85 12 ILE A 21 ? ? -132.02 -101.70 86 12 VAL A 32 ? ? 176.90 -137.55 87 12 TYR A 34 ? ? 173.75 -46.81 88 12 LYS A 44 ? ? -72.70 -169.67 89 13 VAL A 3 ? ? 62.65 148.41 90 13 SER A 20 ? ? -62.68 -171.26 91 13 ILE A 21 ? ? -94.48 -86.12 92 13 VAL A 32 ? ? -172.98 -126.80 93 13 TYR A 34 ? ? 163.19 -80.37 94 13 LYS A 44 ? ? 62.11 179.98 95 13 LYS A 46 ? ? 67.27 -53.83 96 14 LEU A 2 ? ? 59.28 97.85 97 14 VAL A 3 ? ? -163.55 -161.75 98 14 SER A 20 ? ? -64.59 -154.54 99 14 ILE A 21 ? ? -112.75 -100.59 100 14 ASP A 31 ? ? -64.85 -71.52 101 14 VAL A 32 ? ? -164.30 -77.38 102 14 THR A 33 ? ? -160.41 -51.44 103 14 TYR A 34 ? ? 176.68 -70.35 104 15 LEU A 2 ? ? 61.11 76.04 105 15 VAL A 3 ? ? -57.73 -6.83 106 15 SER A 20 ? ? -64.47 -164.62 107 15 ILE A 21 ? ? -87.08 -107.98 108 15 VAL A 32 ? ? 162.51 -95.59 109 15 THR A 33 ? ? -158.97 -94.70 110 15 TYR A 34 ? ? -137.82 -64.10 111 16 LEU A 19 ? ? -119.77 -162.56 112 16 SER A 20 ? ? -87.13 -110.99 113 16 ILE A 21 ? ? -152.57 -100.00 114 16 VAL A 32 ? ? 177.62 -107.05 115 16 THR A 33 ? ? -143.90 -97.95 116 16 TYR A 34 ? ? -130.96 -66.12 117 16 LYS A 44 ? ? -163.54 70.93 118 16 LYS A 46 ? ? -143.61 -48.96 119 17 LEU A 2 ? ? 51.87 85.56 120 17 ASP A 4 ? ? 47.71 92.62 121 17 SER A 20 ? ? -64.76 -166.54 122 17 ILE A 21 ? ? -102.53 -80.07 123 17 VAL A 32 ? ? 176.40 -121.69 124 17 TYR A 34 ? ? 166.82 -83.24 125 17 LYS A 46 ? ? 51.43 -157.16 126 18 SER A 20 ? ? -65.03 -161.04 127 18 ILE A 21 ? ? -112.77 -76.59 128 18 VAL A 32 ? ? 162.18 -125.94 129 18 TYR A 34 ? ? 177.32 -69.73 130 18 GLN A 45 ? ? -171.41 -51.29 131 18 LYS A 46 ? ? 49.17 89.84 132 19 SER A 20 ? ? -55.67 -159.29 133 19 ILE A 21 ? ? -108.80 -97.50 134 19 VAL A 32 ? ? 173.90 -132.29 135 19 TYR A 34 ? ? 179.96 -48.60 136 19 LYS A 46 ? ? -152.84 -53.99 137 20 LEU A 2 ? ? -156.08 -32.19 138 20 VAL A 3 ? ? -67.51 80.67 139 20 ASP A 4 ? ? -162.14 -45.58 140 20 LEU A 19 ? ? -122.60 -160.12 141 20 SER A 20 ? ? -72.85 -131.33 142 20 ILE A 21 ? ? -138.47 -107.73 143 20 VAL A 32 ? ? 169.24 -93.99 144 20 THR A 33 ? ? -162.93 -78.67 145 20 TYR A 34 ? ? -147.39 -67.87 146 20 LYS A 44 ? ? -115.25 55.37 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 37 ? ? 0.100 'SIDE CHAIN' 2 2 TYR A 37 ? ? 0.120 'SIDE CHAIN' 3 4 TYR A 28 ? ? 0.076 'SIDE CHAIN' 4 4 TYR A 37 ? ? 0.064 'SIDE CHAIN' 5 6 TYR A 37 ? ? 0.107 'SIDE CHAIN' 6 8 TYR A 28 ? ? 0.096 'SIDE CHAIN' 7 9 TYR A 28 ? ? 0.074 'SIDE CHAIN' 8 9 TYR A 37 ? ? 0.091 'SIDE CHAIN' 9 10 TYR A 37 ? ? 0.107 'SIDE CHAIN' 10 11 TYR A 37 ? ? 0.094 'SIDE CHAIN' 11 13 TYR A 37 ? ? 0.072 'SIDE CHAIN' 12 14 TYR A 28 ? ? 0.091 'SIDE CHAIN' 13 17 TYR A 37 ? ? 0.068 'SIDE CHAIN' 14 20 TYR A 37 ? ? 0.107 'SIDE CHAIN' #