data_1PJA # _entry.id 1PJA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1PJA RCSB RCSB019357 WWPDB D_1000019357 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1EI9 _pdbx_database_related.details 'palmitoyl protein thioesterase-1 (PPT1) lysosomal thioesterases' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PJA _pdbx_database_status.recvd_initial_deposition_date 2003-06-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Calero, G.' 1 'Gupta, P.' 2 'Nonato, M.C.' 3 'Tandel, S.' 4 'Biehl, E.R.' 5 'Hofmann, S.L.' 6 'Clardy, J.' 7 # _citation.id primary _citation.title ;The crystal structure of palmitoyl protein thioesterase-2 (PPT2) reveals the basis for divergent substrate specificities of the two lysosomal thioesterases, PPT1 and PPT2. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 37957 _citation.page_last 37964 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12855696 _citation.pdbx_database_id_DOI 10.1074/jbc.M301225200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Calero, G.' 1 ? primary 'Gupta, P.' 2 ? primary 'Nonato, M.C.' 3 ? primary 'Tandel, S.' 4 ? primary 'Biehl, E.R.' 5 ? primary 'Hofmann, S.L.' 6 ? primary 'Clardy, J.' 7 ? # _cell.entry_id 1PJA _cell.length_a 148.520 _cell.length_b 148.520 _cell.length_c 152.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1PJA _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Palmitoyl-protein thioesterase 2 precursor' 34342.289 1 3.1.2.22 ? ? ? 2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 3 ? ? ? ? 4 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Palmitoyl- protein hydrolase 2, PPT-2, G14' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTVLDLFDGRESL RPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSN LYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS ; _entity_poly.pdbx_seq_one_letter_code_can ;MLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTVLDLFDGRESL RPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSN LYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 GLY n 1 4 LEU n 1 5 TRP n 1 6 GLY n 1 7 GLN n 1 8 ARG n 1 9 LEU n 1 10 PRO n 1 11 ALA n 1 12 ALA n 1 13 TRP n 1 14 VAL n 1 15 LEU n 1 16 LEU n 1 17 LEU n 1 18 LEU n 1 19 PRO n 1 20 PHE n 1 21 LEU n 1 22 PRO n 1 23 LEU n 1 24 LEU n 1 25 LEU n 1 26 LEU n 1 27 ALA n 1 28 ALA n 1 29 PRO n 1 30 ALA n 1 31 PRO n 1 32 HIS n 1 33 ARG n 1 34 ALA n 1 35 SER n 1 36 TYR n 1 37 LYS n 1 38 PRO n 1 39 VAL n 1 40 ILE n 1 41 VAL n 1 42 VAL n 1 43 HIS n 1 44 GLY n 1 45 LEU n 1 46 PHE n 1 47 ASP n 1 48 SER n 1 49 SER n 1 50 TYR n 1 51 SER n 1 52 PHE n 1 53 ARG n 1 54 HIS n 1 55 LEU n 1 56 LEU n 1 57 GLU n 1 58 TYR n 1 59 ILE n 1 60 ASN n 1 61 GLU n 1 62 THR n 1 63 HIS n 1 64 PRO n 1 65 GLY n 1 66 THR n 1 67 VAL n 1 68 VAL n 1 69 THR n 1 70 VAL n 1 71 LEU n 1 72 ASP n 1 73 LEU n 1 74 PHE n 1 75 ASP n 1 76 GLY n 1 77 ARG n 1 78 GLU n 1 79 SER n 1 80 LEU n 1 81 ARG n 1 82 PRO n 1 83 LEU n 1 84 TRP n 1 85 GLU n 1 86 GLN n 1 87 VAL n 1 88 GLN n 1 89 GLY n 1 90 PHE n 1 91 ARG n 1 92 GLU n 1 93 ALA n 1 94 VAL n 1 95 VAL n 1 96 PRO n 1 97 ILE n 1 98 MET n 1 99 ALA n 1 100 LYS n 1 101 ALA n 1 102 PRO n 1 103 GLN n 1 104 GLY n 1 105 VAL n 1 106 HIS n 1 107 LEU n 1 108 ILE n 1 109 CYS n 1 110 TYR n 1 111 SER n 1 112 GLN n 1 113 GLY n 1 114 GLY n 1 115 LEU n 1 116 VAL n 1 117 CYS n 1 118 ARG n 1 119 ALA n 1 120 LEU n 1 121 LEU n 1 122 SER n 1 123 VAL n 1 124 MET n 1 125 ASP n 1 126 ASP n 1 127 HIS n 1 128 ASN n 1 129 VAL n 1 130 ASP n 1 131 SER n 1 132 PHE n 1 133 ILE n 1 134 SER n 1 135 LEU n 1 136 SER n 1 137 SER n 1 138 PRO n 1 139 GLN n 1 140 MET n 1 141 GLY n 1 142 GLN n 1 143 TYR n 1 144 GLY n 1 145 ASP n 1 146 THR n 1 147 ASP n 1 148 TYR n 1 149 LEU n 1 150 LYS n 1 151 TRP n 1 152 LEU n 1 153 PHE n 1 154 PRO n 1 155 THR n 1 156 SER n 1 157 MET n 1 158 ARG n 1 159 SER n 1 160 ASN n 1 161 LEU n 1 162 TYR n 1 163 ARG n 1 164 ILE n 1 165 CYS n 1 166 TYR n 1 167 SER n 1 168 PRO n 1 169 TRP n 1 170 GLY n 1 171 GLN n 1 172 GLU n 1 173 PHE n 1 174 SER n 1 175 ILE n 1 176 CYS n 1 177 ASN n 1 178 TYR n 1 179 TRP n 1 180 HIS n 1 181 ASP n 1 182 PRO n 1 183 HIS n 1 184 HIS n 1 185 ASP n 1 186 ASP n 1 187 LEU n 1 188 TYR n 1 189 LEU n 1 190 ASN n 1 191 ALA n 1 192 SER n 1 193 SER n 1 194 PHE n 1 195 LEU n 1 196 ALA n 1 197 LEU n 1 198 ILE n 1 199 ASN n 1 200 GLY n 1 201 GLU n 1 202 ARG n 1 203 ASP n 1 204 HIS n 1 205 PRO n 1 206 ASN n 1 207 ALA n 1 208 THR n 1 209 VAL n 1 210 TRP n 1 211 ARG n 1 212 LYS n 1 213 ASN n 1 214 PHE n 1 215 LEU n 1 216 ARG n 1 217 VAL n 1 218 GLY n 1 219 HIS n 1 220 LEU n 1 221 VAL n 1 222 LEU n 1 223 ILE n 1 224 GLY n 1 225 GLY n 1 226 PRO n 1 227 ASP n 1 228 ASP n 1 229 GLY n 1 230 VAL n 1 231 ILE n 1 232 THR n 1 233 PRO n 1 234 TRP n 1 235 GLN n 1 236 SER n 1 237 SER n 1 238 PHE n 1 239 PHE n 1 240 GLY n 1 241 PHE n 1 242 TYR n 1 243 ASP n 1 244 ALA n 1 245 ASN n 1 246 GLU n 1 247 THR n 1 248 VAL n 1 249 LEU n 1 250 GLU n 1 251 MET n 1 252 GLU n 1 253 GLU n 1 254 GLN n 1 255 LEU n 1 256 VAL n 1 257 TYR n 1 258 LEU n 1 259 ARG n 1 260 ASP n 1 261 SER n 1 262 PHE n 1 263 GLY n 1 264 LEU n 1 265 LYS n 1 266 THR n 1 267 LEU n 1 268 LEU n 1 269 ALA n 1 270 ARG n 1 271 GLY n 1 272 ALA n 1 273 ILE n 1 274 VAL n 1 275 ARG n 1 276 CYS n 1 277 PRO n 1 278 MET n 1 279 ALA n 1 280 GLY n 1 281 ILE n 1 282 SER n 1 283 HIS n 1 284 THR n 1 285 ALA n 1 286 TRP n 1 287 HIS n 1 288 SER n 1 289 ASN n 1 290 ARG n 1 291 THR n 1 292 LEU n 1 293 TYR n 1 294 GLU n 1 295 THR n 1 296 CYS n 1 297 ILE n 1 298 GLU n 1 299 PRO n 1 300 TRP n 1 301 LEU n 1 302 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PPT2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus Spodoptera _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPT2_HUMAN _struct_ref.pdbx_db_accession Q9UMR5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLGLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTVLDLFDGRESL RPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSN LYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFG FYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PJA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 302 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9UMR5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 302 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 302 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1PJA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '1.8-2.2M ammonium sulfate, 8% methyl-pentane-diol, 100 mM MES , pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.943 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE A1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline A1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.943 # _reflns.entry_id 1PJA _reflns.observed_criterion_sigma_F 2 _reflns.observed_criterion_sigma_I 2 _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 40 _reflns.number_all 34721 _reflns.number_obs 34721 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.046 _reflns.pdbx_netI_over_sigmaI 15.7 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1PJA _refine.ls_d_res_high 2.7 _refine.ls_d_res_low 40 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 27511 _refine.ls_number_reflns_obs 27511 _refine.ls_number_reflns_R_free ? _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_all 0.251 _refine.ls_R_factor_obs 0.251 _refine.ls_R_factor_R_work 0.221 _refine.ls_R_factor_R_free 0.242 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2161 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 2243 _refine_hist.d_res_high 2.7 _refine_hist.d_res_low 40 # _struct.entry_id 1PJA _struct.title ;The crystal structure of palmitoyl protein thioesterase-2 reveals the basis for divergent substrate specificities of the two lysosomal thioesterases (PPT1 and PPT2) ; _struct.pdbx_descriptor 'Palmitoyl-protein thioesterase 2 precursor (E.C.3.1.2.22)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PJA _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'hydrolase, glycoprotein, lysosome' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 48 ? SER A 51 ? SER A 48 SER A 51 5 ? 4 HELX_P HELX_P2 2 PHE A 52 ? HIS A 63 ? PHE A 52 HIS A 63 1 ? 12 HELX_P HELX_P3 3 GLY A 76 ? ARG A 81 ? GLY A 76 ARG A 81 5 ? 6 HELX_P HELX_P4 4 PRO A 82 ? ALA A 101 ? PRO A 82 ALA A 101 1 ? 20 HELX_P HELX_P5 5 SER A 111 ? MET A 124 ? SER A 111 MET A 124 1 ? 14 HELX_P HELX_P6 6 THR A 146 ? PHE A 153 ? THR A 146 PHE A 153 1 ? 8 HELX_P HELX_P7 7 MET A 157 ? TYR A 166 ? MET A 157 TYR A 166 1 ? 10 HELX_P HELX_P8 8 TRP A 169 ? PHE A 173 ? TRP A 169 PHE A 173 5 ? 5 HELX_P HELX_P9 9 SER A 174 ? TRP A 179 ? SER A 174 TRP A 179 5 ? 6 HELX_P HELX_P10 10 HIS A 184 ? SER A 192 ? HIS A 184 SER A 192 1 ? 9 HELX_P HELX_P11 11 PHE A 194 ? ASN A 199 ? PHE A 194 ASN A 199 1 ? 6 HELX_P HELX_P12 12 ASN A 206 ? LEU A 215 ? ASN A 206 LEU A 215 1 ? 10 HELX_P HELX_P13 13 PRO A 233 ? PHE A 239 ? PRO A 233 PHE A 239 5 ? 7 HELX_P HELX_P14 14 GLU A 250 ? GLU A 253 ? GLU A 250 GLU A 253 5 ? 4 HELX_P HELX_P15 15 GLN A 254 ? ARG A 259 ? GLN A 254 ARG A 259 1 ? 6 HELX_P HELX_P16 16 GLY A 263 ? ARG A 270 ? GLY A 263 ARG A 270 1 ? 8 HELX_P HELX_P17 17 ASN A 289 ? ILE A 297 ? ASN A 289 ILE A 297 1 ? 9 HELX_P HELX_P18 18 GLU A 298 ? LEU A 301 ? GLU A 298 LEU A 301 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 109 A CYS 117 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf2 disulf ? ? A CYS 165 SG ? ? ? 1_555 A CYS 176 SG ? ? A CYS 165 A CYS 176 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf3 disulf ? ? A CYS 276 SG ? ? ? 1_555 A CYS 296 SG ? ? A CYS 276 A CYS 296 1_555 ? ? ? ? ? ? ? 2.035 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 232 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 232 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 233 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 233 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.37 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 68 ? VAL A 70 ? VAL A 68 VAL A 70 A 2 VAL A 39 ? VAL A 42 ? VAL A 39 VAL A 42 A 3 VAL A 105 ? TYR A 110 ? VAL A 105 TYR A 110 A 4 VAL A 129 ? LEU A 135 ? VAL A 129 LEU A 135 A 5 HIS A 219 ? GLY A 224 ? HIS A 219 GLY A 224 A 6 ILE A 273 ? PRO A 277 ? ILE A 273 PRO A 277 B 1 PHE A 241 ? TYR A 242 ? PHE A 241 TYR A 242 B 2 VAL A 248 ? LEU A 249 ? VAL A 248 LEU A 249 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 69 ? O THR A 69 N VAL A 39 ? N VAL A 39 A 2 3 N VAL A 42 ? N VAL A 42 O TYR A 110 ? O TYR A 110 A 3 4 N LEU A 107 ? N LEU A 107 O ILE A 133 ? O ILE A 133 A 4 5 N PHE A 132 ? N PHE A 132 O HIS A 219 ? O HIS A 219 A 5 6 N LEU A 222 ? N LEU A 222 O CYS A 276 ? O CYS A 276 B 1 2 N PHE A 241 ? N PHE A 241 O LEU A 249 ? O LEU A 249 # _database_PDB_matrix.entry_id 1PJA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PJA _atom_sites.fract_transf_matrix[1][1] 0.006733 _atom_sites.fract_transf_matrix[1][2] 0.003887 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007775 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006557 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 GLY 3 3 ? ? ? A . n A 1 4 LEU 4 4 ? ? ? A . n A 1 5 TRP 5 5 ? ? ? A . n A 1 6 GLY 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 ARG 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 PRO 10 10 ? ? ? A . n A 1 11 ALA 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 TRP 13 13 ? ? ? A . n A 1 14 VAL 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LEU 16 16 ? ? ? A . n A 1 17 LEU 17 17 ? ? ? A . n A 1 18 LEU 18 18 ? ? ? A . n A 1 19 PRO 19 19 ? ? ? A . n A 1 20 PHE 20 20 ? ? ? A . n A 1 21 LEU 21 21 ? ? ? A . n A 1 22 PRO 22 22 ? ? ? A . n A 1 23 LEU 23 23 ? ? ? A . n A 1 24 LEU 24 24 ? ? ? A . n A 1 25 LEU 25 25 ? ? ? A . n A 1 26 LEU 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 ALA 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 PRO 31 31 ? ? ? A . n A 1 32 HIS 32 32 ? ? ? A . n A 1 33 ARG 33 33 ? ? ? A . n A 1 34 ALA 34 34 ? ? ? A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 MET 98 98 98 MET MET A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 MET 140 140 140 MET MET A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 TYR 143 143 143 TYR TYR A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 LYS 150 150 150 LYS LYS A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 SER 156 156 156 SER SER A . n A 1 157 MET 157 157 157 MET MET A . n A 1 158 ARG 158 158 158 ARG ARG A . n A 1 159 SER 159 159 159 SER SER A . n A 1 160 ASN 160 160 160 ASN ASN A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 ILE 164 164 164 ILE ILE A . n A 1 165 CYS 165 165 165 CYS CYS A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 SER 167 167 167 SER SER A . n A 1 168 PRO 168 168 168 PRO PRO A . n A 1 169 TRP 169 169 169 TRP TRP A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 GLN 171 171 171 GLN GLN A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 PHE 173 173 173 PHE PHE A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 CYS 176 176 176 CYS CYS A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 HIS 180 180 180 HIS HIS A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 TYR 188 188 188 TYR TYR A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 ALA 191 191 191 ALA ALA A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 ASN 199 199 199 ASN ASN A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 GLU 201 201 201 GLU GLU A . n A 1 202 ARG 202 202 202 ARG ARG A . n A 1 203 ASP 203 203 203 ASP ASP A . n A 1 204 HIS 204 204 204 HIS HIS A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 ASN 206 206 206 ASN ASN A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 THR 208 208 208 THR THR A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 TRP 210 210 210 TRP TRP A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 LYS 212 212 212 LYS LYS A . n A 1 213 ASN 213 213 213 ASN ASN A . n A 1 214 PHE 214 214 214 PHE PHE A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 LEU 222 222 222 LEU LEU A . n A 1 223 ILE 223 223 223 ILE ILE A . n A 1 224 GLY 224 224 224 GLY GLY A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 ASP 227 227 227 ASP ASP A . n A 1 228 ASP 228 228 228 ASP ASP A . n A 1 229 GLY 229 229 229 GLY GLY A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 PRO 233 233 233 PRO CPR A . n A 1 234 TRP 234 234 234 TRP TRP A . n A 1 235 GLN 235 235 235 GLN GLN A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 SER 237 237 237 SER SER A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 PHE 239 239 239 PHE PHE A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 TYR 242 242 242 TYR TYR A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 GLU 246 246 246 GLU GLU A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 VAL 248 248 248 VAL VAL A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 GLU 250 250 250 GLU GLU A . n A 1 251 MET 251 251 251 MET MET A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 GLN 254 254 254 GLN GLN A . n A 1 255 LEU 255 255 255 LEU LEU A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 TYR 257 257 257 TYR TYR A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 ARG 259 259 259 ARG ARG A . n A 1 260 ASP 260 260 260 ASP ASP A . n A 1 261 SER 261 261 261 SER SER A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 LEU 264 264 264 LEU LEU A . n A 1 265 LYS 265 265 265 LYS LYS A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 LEU 267 267 267 LEU LEU A . n A 1 268 LEU 268 268 268 LEU LEU A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 ARG 270 270 270 ARG ARG A . n A 1 271 GLY 271 271 271 GLY GLY A . n A 1 272 ALA 272 272 272 ALA ALA A . n A 1 273 ILE 273 273 273 ILE ILE A . n A 1 274 VAL 274 274 274 VAL VAL A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 CYS 276 276 276 CYS CYS A . n A 1 277 PRO 277 277 277 PRO PRO A . n A 1 278 MET 278 278 278 MET MET A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 SER 282 282 282 SER SER A . n A 1 283 HIS 283 283 283 HIS HIS A . n A 1 284 THR 284 284 284 THR THR A . n A 1 285 ALA 285 285 285 ALA ALA A . n A 1 286 TRP 286 286 286 TRP TRP A . n A 1 287 HIS 287 287 287 HIS HIS A . n A 1 288 SER 288 288 288 SER SER A . n A 1 289 ASN 289 289 289 ASN ASN A . n A 1 290 ARG 290 290 290 ARG ARG A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 GLU 294 294 294 GLU GLU A . n A 1 295 THR 295 295 295 THR THR A . n A 1 296 CYS 296 296 296 CYS CYS A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 GLU 298 298 298 GLU GLU A . n A 1 299 PRO 299 299 299 PRO PRO A . n A 1 300 TRP 300 300 300 TRP TRP A . n A 1 301 LEU 301 301 301 LEU LEU A . n A 1 302 SER 302 302 302 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 2285 2285 NAG NAG A . C 3 GOL 1 1614 1614 GOL GOL A . D 3 GOL 1 1615 1615 GOL GOL A . E 3 GOL 1 1616 1616 GOL GOL A . F 4 HOH 1 2286 1 HOH HOH A . F 4 HOH 2 2287 2 HOH HOH A . F 4 HOH 3 2288 3 HOH HOH A . F 4 HOH 4 2289 4 HOH HOH A . F 4 HOH 5 2290 5 HOH HOH A . F 4 HOH 6 2291 6 HOH HOH A . F 4 HOH 7 2292 7 HOH HOH A . F 4 HOH 8 2293 8 HOH HOH A . F 4 HOH 9 2294 9 HOH HOH A . F 4 HOH 10 2295 10 HOH HOH A . F 4 HOH 11 2296 11 HOH HOH A . F 4 HOH 12 2297 12 HOH HOH A . F 4 HOH 13 2298 13 HOH HOH A . F 4 HOH 14 2299 14 HOH HOH A . F 4 HOH 15 2300 15 HOH HOH A . F 4 HOH 16 2301 16 HOH HOH A . F 4 HOH 17 2302 17 HOH HOH A . F 4 HOH 18 2303 18 HOH HOH A . F 4 HOH 19 2304 19 HOH HOH A . F 4 HOH 20 2305 20 HOH HOH A . F 4 HOH 21 2306 21 HOH HOH A . F 4 HOH 22 2307 22 HOH HOH A . F 4 HOH 23 2308 23 HOH HOH A . F 4 HOH 24 2309 24 HOH HOH A . F 4 HOH 25 2310 25 HOH HOH A . F 4 HOH 26 2311 26 HOH HOH A . F 4 HOH 27 2312 27 HOH HOH A . F 4 HOH 28 2313 28 HOH HOH A . F 4 HOH 29 2314 29 HOH HOH A . F 4 HOH 30 2315 30 HOH HOH A . F 4 HOH 31 2316 31 HOH HOH A . F 4 HOH 32 2317 32 HOH HOH A . F 4 HOH 33 2318 33 HOH HOH A . F 4 HOH 34 2319 34 HOH HOH A . F 4 HOH 35 2320 35 HOH HOH A . F 4 HOH 36 2321 36 HOH HOH A . F 4 HOH 37 2322 37 HOH HOH A . F 4 HOH 38 2323 38 HOH HOH A . F 4 HOH 39 2324 39 HOH HOH A . F 4 HOH 40 2325 40 HOH HOH A . F 4 HOH 41 2326 41 HOH HOH A . F 4 HOH 42 2327 42 HOH HOH A . F 4 HOH 43 2328 43 HOH HOH A . F 4 HOH 44 2329 44 HOH HOH A . F 4 HOH 45 2330 45 HOH HOH A . F 4 HOH 46 2331 46 HOH HOH A . F 4 HOH 47 2332 47 HOH HOH A . F 4 HOH 48 2333 48 HOH HOH A . F 4 HOH 49 2334 49 HOH HOH A . F 4 HOH 50 2335 50 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-09-02 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 4 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' Advisory 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp 2 4 'Structure model' entity 3 4 'Structure model' pdbx_chem_comp_identifier 4 4 'Structure model' pdbx_entity_nonpoly 5 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 6 4 'Structure model' struct_site 7 4 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_chem_comp.name' 2 4 'Structure model' '_chem_comp.type' 3 4 'Structure model' '_entity.pdbx_description' 4 4 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALA 'data scaling' . ? 2 MOLREP phasing . ? 3 CNS refinement . ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 N A GLY 76 ? ? O A HOH 2296 ? ? 2.06 2 1 NE2 A HIS 287 ? ? O A HOH 2332 ? ? 2.15 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLU _pdbx_validate_symm_contact.auth_seq_id_1 172 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 172 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 10_665 _pdbx_validate_symm_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 63 ? ? -119.83 73.02 2 1 SER A 111 ? ? 46.33 -127.07 3 1 ASP A 130 ? ? -87.08 -81.84 4 1 TYR A 143 ? ? -157.22 77.89 5 1 TYR A 166 ? ? -95.48 41.89 6 1 HIS A 184 ? ? -141.43 44.99 7 1 VAL A 230 ? ? -122.91 -60.92 8 1 SER A 288 ? ? -143.14 46.65 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag N _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id NAG _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 2285 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id O1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id NAG _pdbx_unobs_or_zero_occ_atoms.label_seq_id 1 _pdbx_unobs_or_zero_occ_atoms.label_atom_id O1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A GLY 3 ? A GLY 3 4 1 Y 1 A LEU 4 ? A LEU 4 5 1 Y 1 A TRP 5 ? A TRP 5 6 1 Y 1 A GLY 6 ? A GLY 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A ARG 8 ? A ARG 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A PRO 10 ? A PRO 10 11 1 Y 1 A ALA 11 ? A ALA 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A TRP 13 ? A TRP 13 14 1 Y 1 A VAL 14 ? A VAL 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LEU 16 ? A LEU 16 17 1 Y 1 A LEU 17 ? A LEU 17 18 1 Y 1 A LEU 18 ? A LEU 18 19 1 Y 1 A PRO 19 ? A PRO 19 20 1 Y 1 A PHE 20 ? A PHE 20 21 1 Y 1 A LEU 21 ? A LEU 21 22 1 Y 1 A PRO 22 ? A PRO 22 23 1 Y 1 A LEU 23 ? A LEU 23 24 1 Y 1 A LEU 24 ? A LEU 24 25 1 Y 1 A LEU 25 ? A LEU 25 26 1 Y 1 A LEU 26 ? A LEU 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A ALA 28 ? A ALA 28 29 1 Y 1 A PRO 29 ? A PRO 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A PRO 31 ? A PRO 31 32 1 Y 1 A HIS 32 ? A HIS 32 33 1 Y 1 A ARG 33 ? A ARG 33 34 1 Y 1 A ALA 34 ? A ALA 34 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 GLYCEROL GOL 4 water HOH #