data_1PVE # _entry.id 1PVE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PVE pdb_00001pve 10.2210/pdb1pve/pdb RCSB RCSB019601 ? ? WWPDB D_1000019601 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PVE _pdbx_database_status.recvd_initial_deposition_date 2003-06-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, B.' 1 'Ryu, K.-S.' 2 'Kim, H.J.' 3 'Choi, B.-S.' 4 # _citation.id primary _citation.title 'Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B.' _citation.journal_abbrev 'Febs J.' _citation.journal_volume 272 _citation.page_first 2467 _citation.page_last 2476 _citation.year 2005 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1742-464X _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 15885096 _citation.pdbx_database_id_DOI 10.1111/j.1742-4658.2005.04667.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, B.' 1 ? primary 'Ryu, K.S.' 2 ? primary 'Kim, H.J.' 3 ? primary 'Cho, S.J.' 4 ? primary 'Choi, B.S.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'UV excision repair protein RAD23 homolog B' _entity.formula_weight 8145.148 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'XPC binding domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name HHR23B # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _entity_poly.pdbx_seq_one_letter_code_can GSHMPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 PRO n 1 6 LEU n 1 7 GLU n 1 8 PHE n 1 9 LEU n 1 10 ARG n 1 11 ASN n 1 12 GLN n 1 13 PRO n 1 14 GLN n 1 15 PHE n 1 16 GLN n 1 17 GLN n 1 18 MET n 1 19 ARG n 1 20 GLN n 1 21 ILE n 1 22 ILE n 1 23 GLN n 1 24 GLN n 1 25 ASN n 1 26 PRO n 1 27 SER n 1 28 LEU n 1 29 LEU n 1 30 PRO n 1 31 ALA n 1 32 LEU n 1 33 LEU n 1 34 GLN n 1 35 GLN n 1 36 ILE n 1 37 GLY n 1 38 ARG n 1 39 GLU n 1 40 ASN n 1 41 PRO n 1 42 GLN n 1 43 LEU n 1 44 LEU n 1 45 GLN n 1 46 GLN n 1 47 ILE n 1 48 SER n 1 49 GLN n 1 50 HIS n 1 51 GLN n 1 52 GLU n 1 53 HIS n 1 54 PHE n 1 55 ILE n 1 56 GLN n 1 57 MET n 1 58 LEU n 1 59 ASN n 1 60 GLU n 1 61 PRO n 1 62 VAL n 1 63 GLN n 1 64 GLU n 1 65 ALA n 1 66 GLY n 1 67 GLY n 1 68 GLN n 1 69 GLY n 1 70 GLY n 1 71 GLY n 1 72 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene HH23B _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RD23B_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG _struct_ref.pdbx_align_begin 275 _struct_ref.pdbx_db_accession P54727 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PVE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54727 _struct_ref_seq.db_align_beg 275 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 342 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1PVE GLY A 1 ? UNP P54727 ? ? 'cloning artifact' 1 1 1 1PVE SER A 2 ? UNP P54727 ? ? 'cloning artifact' 2 2 1 1PVE HIS A 3 ? UNP P54727 ? ? 'cloning artifact' 3 3 1 1PVE MET A 4 ? UNP P54727 ? ? 'cloning artifact' 4 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 1 1 3D_13C-separated_NOESY 3 1 1 HNHA # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '40mM Sodium Phosphate, 160mM Sodium Chloride, 10mM CHAPS' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1mM hHR23B(275-342) U-15N, 13C; 40mM phosphate buffer NA; 10mM CHAPS NA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.field_strength 600 # _pdbx_nmr_refine.entry_id 1PVE _pdbx_nmr_refine.method 'Automatic NOE assignment, distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1PVE _pdbx_nmr_details.text ;the structures are based on a total of 1312 restraints, 1242 are NOE-derived distance constraints, 70 dihedral angle restraints ( 14 from Jhnha and 56 from TALOS) ; # _pdbx_nmr_ensemble.entry_id 1PVE _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1PVE _pdbx_nmr_representative.conformer_id 20 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.3c collection Varian 1 NMRPipe . processing 'Frank Delaglio' 2 CYANA 1.6 'structure solution' 'Peter Guentert' 3 Amber 7 refinement 'David A. Case etc' 4 # _exptl.entry_id 1PVE _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1PVE _struct.title 'Solution structure of XPC binding domain of hHR23B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PVE _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'hHR23B, XPC binding domain, NMR solution structure, Nucleotide excision repair, CHAPS, DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 6 ? ARG A 10 ? LEU A 6 ARG A 10 5 ? 5 HELX_P HELX_P2 2 GLN A 17 ? GLN A 23 ? GLN A 17 GLN A 23 1 ? 7 HELX_P HELX_P3 3 ASN A 25 ? SER A 27 ? ASN A 25 SER A 27 5 ? 3 HELX_P HELX_P4 4 LEU A 28 ? ARG A 38 ? LEU A 28 ARG A 38 1 ? 11 HELX_P HELX_P5 5 ASN A 40 ? GLN A 49 ? ASN A 40 GLN A 49 1 ? 10 HELX_P HELX_P6 6 HIS A 50 ? GLU A 60 ? HIS A 50 GLU A 60 1 ? 11 HELX_P HELX_P7 7 GLU A 64 ? GLY A 69 ? GLU A 64 GLY A 69 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 71 A . ? GLY 71 A GLY 72 A ? GLY 72 A 8 -0.26 2 GLY 67 A . ? GLY 67 A GLN 68 A ? GLN 68 A 9 -3.55 3 SER 2 A . ? SER 2 A HIS 3 A ? HIS 3 A 16 -0.77 4 GLU 64 A . ? GLU 64 A ALA 65 A ? ALA 65 A 19 -7.18 5 GLY 67 A . ? GLY 67 A GLN 68 A ? GLN 68 A 19 -4.85 6 GLY 71 A . ? GLY 71 A GLY 72 A ? GLY 72 A 19 -5.20 # _database_PDB_matrix.entry_id 1PVE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1PVE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 MET 18 18 18 MET MET A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2004-08-10 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.10 120.30 3.80 0.50 N 2 3 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.07 120.30 3.77 0.50 N 3 6 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.32 120.30 3.02 0.50 N 4 7 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 123.32 120.30 3.02 0.50 N 5 7 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.32 120.30 3.02 0.50 N 6 11 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.31 120.30 3.01 0.50 N 7 12 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 124.33 120.30 4.03 0.50 N 8 12 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.65 120.30 3.35 0.50 N 9 13 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH1 A ARG 10 ? ? 123.66 120.30 3.36 0.50 N 10 13 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.66 120.30 3.36 0.50 N 11 14 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.34 120.30 3.04 0.50 N 12 15 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.37 120.30 4.07 0.50 N 13 16 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.63 120.30 3.33 0.50 N 14 18 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.02 120.30 3.72 0.50 N 15 20 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 123.59 120.30 3.29 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 4 ? ? -156.16 86.22 2 1 GLN A 17 ? ? -130.75 -47.68 3 3 SER A 2 ? ? -153.96 37.78 4 3 LEU A 6 ? ? 61.53 -10.02 5 3 HIS A 50 ? ? -141.63 28.47 6 3 ALA A 65 ? ? -144.76 -10.39 7 4 GLN A 17 ? ? -128.83 -50.46 8 4 ASN A 40 ? ? -154.16 73.35 9 4 HIS A 50 ? ? -140.63 20.80 10 5 HIS A 50 ? ? -141.69 24.30 11 5 GLU A 64 ? ? 58.96 -166.03 12 6 LEU A 6 ? ? 57.64 20.00 13 6 ARG A 10 ? ? -69.97 26.97 14 6 PRO A 61 ? ? -49.91 154.25 15 7 GLN A 23 ? ? -67.87 2.75 16 7 ASN A 40 ? ? -151.87 73.20 17 8 GLU A 7 ? ? -150.57 -26.52 18 8 GLN A 23 ? ? -68.91 2.30 19 9 LEU A 6 ? ? 60.94 -6.57 20 10 ASN A 11 ? ? -144.46 19.79 21 10 GLN A 17 ? ? -128.12 -51.15 22 10 GLN A 23 ? ? -67.95 2.26 23 10 ASN A 40 ? ? -151.84 72.90 24 10 GLN A 63 ? ? 63.32 -2.65 25 11 MET A 4 ? ? 65.43 153.19 26 11 GLN A 23 ? ? -66.40 0.68 27 11 ASN A 40 ? ? -153.66 72.69 28 12 ASN A 11 ? ? -144.23 22.22 29 12 GLN A 14 ? ? 48.56 -22.96 30 12 GLN A 17 ? ? -131.68 -51.26 31 12 GLU A 64 ? ? 72.41 -42.96 32 12 ALA A 65 ? ? -141.61 -8.47 33 13 GLN A 14 ? ? 59.14 -15.98 34 13 GLN A 23 ? ? -69.13 1.44 35 13 ASN A 40 ? ? -158.82 76.13 36 13 HIS A 50 ? ? -141.18 27.52 37 13 GLU A 64 ? ? -137.92 -40.51 38 13 ALA A 65 ? ? 47.78 18.90 39 14 ALA A 65 ? ? 58.19 -28.49 40 15 MET A 4 ? ? -151.06 21.77 41 15 ARG A 10 ? ? -69.72 2.52 42 16 ASN A 40 ? ? -155.19 74.75 43 17 SER A 2 ? ? -69.68 91.54 44 17 GLN A 17 ? ? -135.02 -42.04 45 17 HIS A 50 ? ? -140.78 26.18 46 18 SER A 2 ? ? -142.20 -31.17 47 18 HIS A 3 ? ? -150.70 -22.21 48 18 ASN A 40 ? ? -151.36 61.26 49 18 GLN A 63 ? ? 55.48 17.69 50 18 GLU A 64 ? ? -147.11 -31.46 51 19 SER A 2 ? ? 57.49 -174.67 52 19 GLN A 23 ? ? -66.91 2.79 53 19 ASN A 40 ? ? -151.70 74.88 54 19 HIS A 50 ? ? -140.84 18.24 55 19 GLN A 63 ? ? -145.94 -41.77 56 19 ALA A 65 ? ? -150.14 -18.88 57 20 HIS A 3 ? ? 58.15 172.08 58 20 GLN A 23 ? ? -67.26 2.29 59 20 GLU A 39 ? ? -142.54 -25.49 60 20 GLN A 56 ? ? -59.60 -9.95 61 20 GLN A 68 ? ? -140.59 13.62 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 20 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 19 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.080 _pdbx_validate_planes.type 'SIDE CHAIN' #