data_1PWJ # _entry.id 1PWJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1PWJ pdb_00001pwj 10.2210/pdb1pwj/pdb RCSB RCSB019638 ? ? WWPDB D_1000019638 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-10-21 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1PWJ _pdbx_database_status.recvd_initial_deposition_date 2003-07-02 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 1F3C 'Solution structure of DLC8 dimer' unspecified PDB 1F95 'Solution structure of DLC8/Bim peptide complex' unspecified PDB 1F96 'Solution structure of DLC8/nNOS peptide complex' unspecified PDB 1PWK 'the same protein complexed with insertion code' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, W.' 1 'Lo, K.W.-H.' 2 'Kan, H.-M.' 3 'Fan, J.-S.' 4 'Zhang, M.' 5 # _citation.id primary _citation.title 'Structure of the Monomeric 8-kDa Dynein Light Chain and Mechanism of the Domain-swapped Dimer Assembly' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 278 _citation.page_first 41491 _citation.page_last 41499 _citation.year 2003 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12904292 _citation.pdbx_database_id_DOI 10.1074/jbc.M307118200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, W.' 1 ? primary 'Lo, K.W.-H.' 2 ? primary 'Kan, H.-M.' 3 ? primary 'Fan, J.-S.' 4 ? primary 'Zhang, M.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'dynein light chain-2' _entity.formula_weight 10364.847 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Monomeric 8kDa Dynein Light Chain' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; _entity_poly.pdbx_seq_one_letter_code_can ;MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASP n 1 4 ARG n 1 5 LYS n 1 6 ALA n 1 7 VAL n 1 8 ILE n 1 9 LYS n 1 10 ASN n 1 11 ALA n 1 12 ASP n 1 13 MET n 1 14 SER n 1 15 GLU n 1 16 ASP n 1 17 MET n 1 18 GLN n 1 19 GLN n 1 20 ASP n 1 21 ALA n 1 22 VAL n 1 23 ASP n 1 24 CYS n 1 25 ALA n 1 26 THR n 1 27 GLN n 1 28 ALA n 1 29 MET n 1 30 GLU n 1 31 LYS n 1 32 TYR n 1 33 ASN n 1 34 ILE n 1 35 GLU n 1 36 LYS n 1 37 ASP n 1 38 ILE n 1 39 ALA n 1 40 ALA n 1 41 TYR n 1 42 ILE n 1 43 LYS n 1 44 LYS n 1 45 GLU n 1 46 PHE n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 TYR n 1 51 ASN n 1 52 PRO n 1 53 THR n 1 54 TRP n 1 55 HIS n 1 56 CYS n 1 57 ILE n 1 58 VAL n 1 59 GLY n 1 60 ARG n 1 61 ASN n 1 62 PHE n 1 63 GLY n 1 64 SER n 1 65 TYR n 1 66 VAL n 1 67 THR n 1 68 HIS n 1 69 GLU n 1 70 THR n 1 71 LYS n 1 72 HIS n 1 73 PHE n 1 74 ILE n 1 75 TYR n 1 76 PHE n 1 77 TYR n 1 78 LEU n 1 79 GLY n 1 80 GLN n 1 81 VAL n 1 82 ALA n 1 83 ILE n 1 84 LEU n 1 85 LEU n 1 86 PHE n 1 87 LYS n 1 88 SER n 1 89 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus Rattus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 MET 13 13 13 MET MET A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 MET 29 29 29 MET MET A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 CYS 56 56 56 CYS CYS A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 GLY 89 89 89 GLY GLY A . n # _exptl.entry_id 1PWJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 1PWJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1PWJ _struct.title 'Structure of the Monomeric 8-kDa Dynein Light Chain and Mechanism of Domain Swapped Dimer Assembly' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1PWJ _struct_keywords.pdbx_keywords 'CONTRACTILE PROTEIN' _struct_keywords.text 'Dynein, Dynein Light Chain, Dimer-monomer Equilibrium, Domain swapping, CONTRACTILE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYL2_MOUSE _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession Q9D0M5 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1PWJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9D0M5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 89 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 89 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 15 ? TYR A 32 ? GLU A 15 TYR A 32 1 ? 18 HELX_P HELX_P2 2 GLU A 35 ? ASN A 51 ? GLU A 35 ASN A 51 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 1 -0.04 2 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 2 -0.12 3 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 3 -0.18 4 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 4 -0.08 5 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 5 0.00 6 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 6 0.10 7 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 7 0.07 8 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 8 -0.08 9 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 9 -0.01 10 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 10 0.02 11 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 11 -0.03 12 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 12 -0.04 13 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 13 -0.01 14 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 14 -0.06 15 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 15 0.02 16 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 16 -0.05 17 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 17 -0.03 18 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 18 -0.11 19 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 19 0.07 20 PRO 52 A . ? PRO 52 A THR 53 A ? THR 53 A 20 -0.18 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 7 ? ALA A 11 ? VAL A 7 ALA A 11 A 2 HIS A 72 ? LEU A 78 ? HIS A 72 LEU A 78 A 3 VAL A 81 ? LYS A 87 ? VAL A 81 LYS A 87 A 4 ILE A 57 ? GLY A 59 ? ILE A 57 GLY A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 7 ? N VAL A 7 O TYR A 77 ? O TYR A 77 A 2 3 N LEU A 78 ? N LEU A 78 O VAL A 81 ? O VAL A 81 A 3 4 O ALA A 82 ? O ALA A 82 N GLY A 59 ? N GLY A 59 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 7 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 14 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 MET _pdbx_validate_close_contact.auth_seq_id_2 17 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? -177.66 100.31 2 1 ALA A 6 ? ? -177.78 115.56 3 1 ASN A 10 ? ? -168.45 114.62 4 1 SER A 14 ? ? -73.38 38.01 5 1 GLU A 15 ? ? 68.65 -43.91 6 1 ASN A 33 ? ? -158.04 27.49 7 1 GLU A 35 ? ? 76.56 -54.46 8 1 LYS A 49 ? ? -138.00 -42.87 9 1 ASN A 51 ? ? 62.50 142.72 10 1 PRO A 52 ? ? -50.00 173.91 11 1 TRP A 54 ? ? -102.32 -167.29 12 1 HIS A 55 ? ? -176.14 90.91 13 1 ARG A 60 ? ? -140.97 -75.86 14 1 ASN A 61 ? ? -161.07 23.10 15 1 TYR A 65 ? ? -165.77 31.60 16 1 VAL A 66 ? ? -84.60 -72.77 17 1 GLU A 69 ? ? -103.88 -63.60 18 1 THR A 70 ? ? -150.94 -116.71 19 1 LYS A 71 ? ? -154.29 30.61 20 1 HIS A 72 ? ? -105.94 68.05 21 1 ILE A 74 ? ? -160.40 110.47 22 2 ASP A 3 ? ? -93.36 48.16 23 2 ARG A 4 ? ? 78.36 108.79 24 2 ALA A 6 ? ? 169.22 103.55 25 2 ASN A 10 ? ? -171.90 112.08 26 2 SER A 14 ? ? -50.54 -95.25 27 2 GLU A 15 ? ? -162.99 -36.93 28 2 ASN A 51 ? ? 58.98 161.17 29 2 HIS A 55 ? ? -179.98 85.23 30 2 VAL A 58 ? ? -119.48 62.39 31 2 ARG A 60 ? ? -144.94 -65.25 32 2 ASN A 61 ? ? -156.87 19.30 33 2 PHE A 62 ? ? -67.49 5.16 34 2 SER A 64 ? ? -69.08 55.47 35 2 TYR A 65 ? ? -99.22 35.11 36 2 GLU A 69 ? ? 156.66 45.49 37 2 THR A 70 ? ? -94.04 -84.05 38 2 LYS A 71 ? ? 74.84 -12.41 39 2 ILE A 74 ? ? -160.93 113.16 40 2 PHE A 76 ? ? -170.27 137.49 41 2 LYS A 87 ? ? -108.25 76.95 42 3 ASP A 3 ? ? 62.29 90.26 43 3 LYS A 5 ? ? -113.90 50.01 44 3 ALA A 6 ? ? 67.27 108.86 45 3 LYS A 9 ? ? -98.77 36.40 46 3 ASN A 10 ? ? 95.22 113.94 47 3 SER A 14 ? ? 53.72 99.71 48 3 ASN A 33 ? ? -141.53 30.07 49 3 GLU A 35 ? ? 76.83 -52.68 50 3 LYS A 49 ? ? -130.25 -44.15 51 3 ASN A 51 ? ? 62.03 153.91 52 3 HIS A 55 ? ? -178.69 94.83 53 3 ARG A 60 ? ? -152.40 -44.10 54 3 ASN A 61 ? ? 157.61 -4.80 55 3 PHE A 62 ? ? -33.36 -36.08 56 3 SER A 64 ? ? 59.85 75.89 57 3 VAL A 66 ? ? -91.96 -73.62 58 3 GLU A 69 ? ? -91.03 -76.58 59 3 THR A 70 ? ? -172.01 -99.05 60 3 LYS A 71 ? ? -146.88 26.53 61 3 HIS A 72 ? ? -118.42 74.45 62 3 PHE A 76 ? ? -170.09 111.08 63 4 ASP A 3 ? ? 60.41 76.72 64 4 ALA A 6 ? ? -177.98 100.91 65 4 ASN A 10 ? ? -178.99 110.92 66 4 ASP A 12 ? ? -143.47 18.22 67 4 MET A 13 ? ? -69.50 65.65 68 4 SER A 14 ? ? 56.97 12.70 69 4 GLU A 15 ? ? 69.35 -49.77 70 4 GLU A 35 ? ? 76.85 -54.51 71 4 ASN A 51 ? ? 61.53 150.63 72 4 PRO A 52 ? ? -56.92 172.55 73 4 ARG A 60 ? ? -126.68 -77.10 74 4 ASN A 61 ? ? -156.53 19.44 75 4 SER A 64 ? ? -60.88 -95.96 76 4 GLU A 69 ? ? -82.01 -77.25 77 4 THR A 70 ? ? -172.42 -86.63 78 4 LYS A 71 ? ? -166.95 29.92 79 4 ILE A 74 ? ? -162.29 111.25 80 4 PHE A 76 ? ? -168.18 116.40 81 5 ASP A 3 ? ? -161.93 30.62 82 5 ARG A 4 ? ? -107.08 -73.73 83 5 LYS A 5 ? ? 58.24 91.39 84 5 ALA A 6 ? ? 62.25 98.46 85 5 ASN A 10 ? ? 87.68 106.68 86 5 ASP A 12 ? ? -168.60 19.22 87 5 GLU A 15 ? ? 70.50 -51.18 88 5 ASN A 33 ? ? -173.97 35.55 89 5 LYS A 36 ? ? -129.07 -54.44 90 5 LYS A 49 ? ? -155.00 -44.36 91 5 ASN A 51 ? ? 63.53 162.33 92 5 PRO A 52 ? ? -46.32 173.49 93 5 HIS A 55 ? ? -163.45 61.80 94 5 VAL A 58 ? ? -141.34 53.83 95 5 ARG A 60 ? ? -177.23 -48.80 96 5 ASN A 61 ? ? -172.50 18.54 97 5 SER A 64 ? ? 51.41 75.31 98 5 TYR A 65 ? ? -143.10 29.72 99 5 GLU A 69 ? ? -160.47 50.58 100 5 HIS A 72 ? ? -171.91 99.92 101 5 PHE A 76 ? ? -170.47 132.37 102 6 ASP A 3 ? ? -163.92 71.86 103 6 LYS A 5 ? ? -90.92 46.57 104 6 ALA A 6 ? ? -177.44 93.33 105 6 ASN A 10 ? ? 88.97 85.97 106 6 ASP A 12 ? ? -148.93 21.57 107 6 MET A 13 ? ? -94.54 42.27 108 6 SER A 14 ? ? 68.19 111.94 109 6 GLU A 15 ? ? -33.69 -34.62 110 6 ASN A 51 ? ? 59.89 156.78 111 6 HIS A 55 ? ? -174.31 72.64 112 6 ARG A 60 ? ? -123.60 -83.75 113 6 ASN A 61 ? ? -152.34 10.96 114 6 GLU A 69 ? ? -108.55 -67.51 115 6 THR A 70 ? ? 80.47 0.60 116 6 PHE A 76 ? ? -170.28 122.22 117 6 GLN A 80 ? ? -149.02 25.70 118 7 ASP A 3 ? ? -158.26 82.70 119 7 LYS A 5 ? ? -149.24 57.29 120 7 ALA A 6 ? ? -179.97 103.69 121 7 ASN A 10 ? ? 179.66 74.41 122 7 ASP A 12 ? ? -146.78 23.55 123 7 MET A 13 ? ? -107.90 47.58 124 7 SER A 14 ? ? 74.37 114.82 125 7 GLU A 15 ? ? -32.56 -35.67 126 7 ASN A 33 ? ? -156.54 45.23 127 7 GLU A 35 ? ? 76.44 -56.07 128 7 TYR A 50 ? ? -148.61 -79.47 129 7 ASN A 51 ? ? -177.98 135.77 130 7 ARG A 60 ? ? -157.99 66.54 131 7 ASN A 61 ? ? 49.46 15.67 132 7 SER A 64 ? ? 49.34 70.18 133 7 TYR A 65 ? ? -149.65 50.59 134 7 GLU A 69 ? ? 153.52 49.06 135 7 THR A 70 ? ? -103.10 -86.79 136 7 LYS A 71 ? ? 75.35 -13.86 137 8 ARG A 4 ? ? -117.73 -168.65 138 8 ALA A 6 ? ? -171.11 84.06 139 8 ASN A 10 ? ? 172.66 135.97 140 8 MET A 13 ? ? -90.70 34.34 141 8 SER A 14 ? ? 68.40 112.02 142 8 GLU A 15 ? ? -27.58 -39.08 143 8 ASN A 33 ? ? -147.67 27.94 144 8 LYS A 49 ? ? -149.97 41.44 145 8 TYR A 50 ? ? -132.78 -86.63 146 8 ASN A 51 ? ? 179.59 104.78 147 8 ARG A 60 ? ? -125.22 -85.84 148 8 ASN A 61 ? ? -146.41 13.81 149 8 SER A 64 ? ? 79.58 116.58 150 8 THR A 67 ? ? -134.82 -32.63 151 8 THR A 70 ? ? -134.40 -44.67 152 8 LYS A 71 ? ? 108.69 32.83 153 8 ILE A 74 ? ? -168.07 111.00 154 8 PHE A 76 ? ? -170.37 123.67 155 9 LYS A 5 ? ? -168.63 30.64 156 9 ALA A 6 ? ? 61.69 132.29 157 9 SER A 14 ? ? 53.05 18.01 158 9 GLU A 15 ? ? 70.50 -51.78 159 9 ASN A 33 ? ? -146.64 29.71 160 9 ILE A 34 ? ? -94.05 -86.15 161 9 GLU A 35 ? ? 171.50 -39.02 162 9 LYS A 49 ? ? -156.01 -45.24 163 9 ASN A 51 ? ? 61.35 154.66 164 9 ARG A 60 ? ? -165.50 -48.92 165 9 ASN A 61 ? ? -173.39 21.10 166 9 TYR A 65 ? ? -156.60 66.10 167 9 VAL A 66 ? ? -129.25 -55.26 168 9 GLU A 69 ? ? -135.31 -48.16 169 9 HIS A 72 ? ? 155.98 117.85 170 9 ILE A 74 ? ? -172.45 108.58 171 9 GLN A 80 ? ? -142.24 16.36 172 10 SER A 2 ? ? 61.74 152.51 173 10 ASP A 3 ? ? -176.74 82.22 174 10 LYS A 5 ? ? 63.67 86.31 175 10 ALA A 6 ? ? 66.37 124.20 176 10 SER A 14 ? ? -40.07 -74.56 177 10 GLU A 15 ? ? 177.71 -31.62 178 10 ASN A 33 ? ? -144.50 18.57 179 10 GLU A 35 ? ? 74.94 -54.02 180 10 LYS A 49 ? ? -101.84 -61.14 181 10 ASN A 51 ? ? 59.79 157.14 182 10 PRO A 52 ? ? -57.30 172.63 183 10 TRP A 54 ? ? -102.12 -169.93 184 10 HIS A 55 ? ? 178.17 75.98 185 10 ARG A 60 ? ? -142.72 -80.69 186 10 ASN A 61 ? ? -156.30 14.43 187 10 TYR A 65 ? ? -89.47 30.70 188 10 VAL A 66 ? ? -46.84 -77.19 189 10 GLU A 69 ? ? -82.39 -73.62 190 10 THR A 70 ? ? -175.61 -86.64 191 10 LYS A 71 ? ? -163.47 26.15 192 10 ILE A 74 ? ? 177.68 111.72 193 11 SER A 2 ? ? -179.17 -175.23 194 11 ASP A 3 ? ? -173.47 82.38 195 11 LYS A 5 ? ? -98.08 33.13 196 11 ALA A 6 ? ? -171.62 93.92 197 11 ASN A 10 ? ? -169.88 110.73 198 11 MET A 13 ? ? -94.19 58.87 199 11 SER A 14 ? ? 64.18 111.85 200 11 GLU A 15 ? ? -35.08 -34.51 201 11 LYS A 49 ? ? -145.86 -44.37 202 11 ASN A 51 ? ? 61.61 154.00 203 11 PRO A 52 ? ? -54.01 174.77 204 11 HIS A 55 ? ? -179.51 -179.63 205 11 ARG A 60 ? ? -149.79 -82.09 206 11 ASN A 61 ? ? -155.50 13.02 207 11 SER A 64 ? ? -50.11 -87.36 208 11 GLU A 69 ? ? 155.22 45.85 209 11 THR A 70 ? ? -92.31 -85.96 210 11 LYS A 71 ? ? 76.12 -12.32 211 12 SER A 2 ? ? -150.00 42.89 212 12 ARG A 4 ? ? -123.61 -168.77 213 12 LYS A 5 ? ? -174.69 55.29 214 12 ALA A 6 ? ? -177.52 83.76 215 12 ASN A 10 ? ? 177.44 119.58 216 12 SER A 14 ? ? -39.67 -79.68 217 12 GLU A 15 ? ? -178.50 -29.68 218 12 ASN A 33 ? ? -143.86 23.66 219 12 GLU A 35 ? ? 76.71 -54.12 220 12 LYS A 49 ? ? -164.07 32.14 221 12 ASN A 51 ? ? 62.99 134.64 222 12 CYS A 56 ? ? -55.53 106.95 223 12 ARG A 60 ? ? -149.84 -77.91 224 12 ASN A 61 ? ? -154.96 14.66 225 12 SER A 64 ? ? -44.70 -76.79 226 12 GLU A 69 ? ? 157.13 44.75 227 12 THR A 70 ? ? -86.77 -81.89 228 12 LYS A 71 ? ? 75.91 -3.73 229 12 ILE A 74 ? ? -162.42 110.94 230 12 PHE A 76 ? ? -170.17 127.83 231 12 GLN A 80 ? ? -149.56 24.93 232 12 SER A 88 ? ? -69.02 67.58 233 13 LYS A 5 ? ? -168.63 30.64 234 13 ALA A 6 ? ? 61.69 132.29 235 13 SER A 14 ? ? 53.05 18.01 236 13 GLU A 15 ? ? 70.50 -51.78 237 13 ASN A 33 ? ? -146.64 29.71 238 13 ILE A 34 ? ? -94.05 -86.15 239 13 GLU A 35 ? ? 171.50 -39.02 240 13 LYS A 49 ? ? -156.01 -45.24 241 13 ASN A 51 ? ? 61.35 154.66 242 13 ARG A 60 ? ? -165.50 -48.92 243 13 ASN A 61 ? ? -173.39 21.10 244 13 TYR A 65 ? ? -156.60 66.10 245 13 VAL A 66 ? ? -129.25 -55.26 246 13 GLU A 69 ? ? -135.31 -48.16 247 13 HIS A 72 ? ? 155.98 117.85 248 13 ILE A 74 ? ? -172.45 108.58 249 13 GLN A 80 ? ? -142.24 16.36 250 14 ARG A 4 ? ? -73.25 -73.12 251 14 LYS A 5 ? ? -164.90 31.74 252 14 ALA A 6 ? ? 179.35 97.51 253 14 ASN A 10 ? ? 173.47 129.66 254 14 SER A 14 ? ? 64.56 110.32 255 14 GLU A 35 ? ? 77.94 -54.84 256 14 LYS A 48 ? ? -90.27 30.43 257 14 LYS A 49 ? ? -152.75 -43.49 258 14 ASN A 51 ? ? 62.71 156.82 259 14 PRO A 52 ? ? -54.49 173.52 260 14 TRP A 54 ? ? -119.30 -168.67 261 14 HIS A 55 ? ? -168.25 63.97 262 14 ARG A 60 ? ? -154.97 -80.90 263 14 ASN A 61 ? ? -160.92 17.88 264 14 SER A 64 ? ? 49.60 26.23 265 14 VAL A 66 ? ? -75.53 -71.34 266 14 THR A 70 ? ? -162.89 -101.71 267 14 LYS A 71 ? ? 179.95 25.81 268 14 HIS A 72 ? ? -107.83 68.02 269 14 ILE A 74 ? ? -169.65 109.13 270 14 PHE A 76 ? ? -166.39 112.13 271 15 ASP A 3 ? ? -163.96 75.56 272 15 LYS A 5 ? ? 59.56 80.40 273 15 ALA A 6 ? ? 63.48 128.66 274 15 ASN A 10 ? ? -165.48 85.60 275 15 SER A 14 ? ? -41.63 -78.26 276 15 GLU A 15 ? ? -178.27 -31.12 277 15 ASN A 33 ? ? -154.48 54.79 278 15 GLU A 35 ? ? 72.69 -54.47 279 15 ASN A 51 ? ? 62.61 138.68 280 15 PRO A 52 ? ? -55.52 172.49 281 15 ARG A 60 ? ? -135.29 -84.16 282 15 ASN A 61 ? ? -151.11 12.79 283 15 VAL A 66 ? ? -130.82 -38.22 284 15 THR A 70 ? ? -158.96 -95.97 285 15 LYS A 71 ? ? 156.36 2.23 286 15 PHE A 73 ? ? -111.83 -168.14 287 15 PHE A 76 ? ? -170.20 123.96 288 16 ALA A 6 ? ? -176.32 82.06 289 16 ASN A 10 ? ? -164.00 119.00 290 16 SER A 14 ? ? 68.34 -63.22 291 16 GLU A 15 ? ? 150.56 -49.02 292 16 GLU A 35 ? ? 77.55 -54.81 293 16 ASN A 51 ? ? 61.73 153.46 294 16 PRO A 52 ? ? -55.19 170.91 295 16 HIS A 55 ? ? -171.77 115.44 296 16 ARG A 60 ? ? -123.43 -65.32 297 16 ASN A 61 ? ? -155.06 20.81 298 16 TYR A 65 ? ? -146.28 24.53 299 16 GLU A 69 ? ? -93.71 -76.34 300 16 THR A 70 ? ? -163.45 -107.95 301 16 LYS A 71 ? ? -153.20 32.21 302 16 HIS A 72 ? ? -109.24 72.16 303 16 ILE A 74 ? ? 166.37 107.52 304 16 GLN A 80 ? ? -141.19 29.62 305 16 SER A 88 ? ? -111.57 76.66 306 17 SER A 2 ? ? 50.40 -175.93 307 17 ASP A 3 ? ? -162.57 85.83 308 17 LYS A 5 ? ? -168.79 97.48 309 17 ALA A 6 ? ? 66.73 101.04 310 17 ASN A 10 ? ? 179.17 130.96 311 17 MET A 13 ? ? -97.45 49.07 312 17 SER A 14 ? ? 70.48 -63.05 313 17 GLU A 15 ? ? 159.23 -42.25 314 17 LYS A 49 ? ? -152.25 -44.79 315 17 ASN A 51 ? ? 62.99 141.62 316 17 PRO A 52 ? ? -52.90 170.67 317 17 ARG A 60 ? ? -153.11 -78.64 318 17 ASN A 61 ? ? -162.01 24.22 319 17 PHE A 62 ? ? -67.83 8.58 320 17 SER A 64 ? ? 78.55 41.04 321 17 TYR A 65 ? ? -179.31 65.24 322 17 VAL A 66 ? ? -97.58 -63.75 323 17 THR A 70 ? ? -147.40 -112.94 324 17 LYS A 71 ? ? -166.58 33.33 325 18 ALA A 6 ? ? 63.53 134.45 326 18 SER A 14 ? ? 67.79 -65.25 327 18 GLU A 15 ? ? 166.74 -36.18 328 18 ASN A 33 ? ? -159.14 44.85 329 18 GLU A 35 ? ? 79.38 -53.07 330 18 ASN A 51 ? ? 60.69 154.25 331 18 PRO A 52 ? ? -58.99 172.12 332 18 ARG A 60 ? ? -125.75 -84.85 333 18 ASN A 61 ? ? -158.72 15.56 334 18 SER A 64 ? ? 70.69 -53.43 335 18 TYR A 65 ? ? -164.88 69.66 336 18 VAL A 66 ? ? -91.26 -74.95 337 18 GLU A 69 ? ? 167.43 50.14 338 18 THR A 70 ? ? -102.93 -86.89 339 18 LYS A 71 ? ? 72.44 -18.24 340 18 GLN A 80 ? ? -140.99 23.68 341 19 ASP A 3 ? ? -98.50 31.21 342 19 LYS A 5 ? ? -155.94 42.47 343 19 ALA A 6 ? ? -160.25 81.13 344 19 SER A 14 ? ? -36.40 -81.11 345 19 GLU A 15 ? ? 176.76 -36.83 346 19 ASN A 33 ? ? -156.02 35.88 347 19 GLU A 35 ? ? 78.12 -55.10 348 19 LYS A 49 ? ? -142.70 -48.06 349 19 ASN A 51 ? ? 60.59 156.07 350 19 HIS A 55 ? ? -157.39 58.20 351 19 ARG A 60 ? ? -157.59 67.24 352 19 ASN A 61 ? ? 52.15 12.90 353 19 TYR A 65 ? ? -98.73 37.70 354 19 GLU A 69 ? ? -92.78 -77.51 355 19 THR A 70 ? ? -176.55 -95.46 356 19 LYS A 71 ? ? -152.79 22.62 357 19 HIS A 72 ? ? -113.12 73.70 358 19 ILE A 74 ? ? 176.39 108.26 359 19 SER A 88 ? ? -100.57 77.01 360 20 ASP A 3 ? ? 62.29 90.26 361 20 LYS A 5 ? ? -113.90 50.01 362 20 ALA A 6 ? ? 67.27 108.86 363 20 LYS A 9 ? ? -98.77 36.40 364 20 ASN A 10 ? ? 95.22 113.94 365 20 SER A 14 ? ? 53.72 99.71 366 20 ASN A 33 ? ? -141.53 30.07 367 20 GLU A 35 ? ? 76.83 -52.68 368 20 LYS A 49 ? ? -130.25 -44.15 369 20 ASN A 51 ? ? 62.03 153.91 370 20 HIS A 55 ? ? -178.69 94.83 371 20 ARG A 60 ? ? -152.40 -44.10 372 20 ASN A 61 ? ? 157.61 -4.80 373 20 PHE A 62 ? ? -33.36 -36.08 374 20 SER A 64 ? ? 59.85 75.89 375 20 VAL A 66 ? ? -91.96 -73.62 376 20 GLU A 69 ? ? -91.03 -76.58 377 20 THR A 70 ? ? -172.01 -99.05 378 20 LYS A 71 ? ? -146.88 26.53 379 20 HIS A 72 ? ? -118.42 74.45 380 20 PHE A 76 ? ? -170.09 111.08 # _pdbx_nmr_ensemble.entry_id 1PWJ _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1mM DLC8b U-15N' '90% H2O, 10% D2O, 2mM d10-DTT' 2 '1mM DLC8b U-15N, 13C' '99.99% D2O, 2mM d10-DTT' 3 '1mM DLC8b' '99.99% D2O, 2mM d10-DTT' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303.3 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 3.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_15N-separated_NOESY 2 2 1 3D_13C-separated_NOESY 3 3 1 '2D NOESY' # _pdbx_nmr_details.entry_id 1PWJ _pdbx_nmr_details.text 'The structure was determined using triple-resonance NMR spectroscopy' # _pdbx_nmr_refine.entry_id 1PWJ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal VNMR 6.1B collection ? 1 NMRPipe 1.7 processing ? 2 CNS 1.0 'structure solution' ? 3 CNS 1.0 refinement ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Varian INOVA 500 2 ? Varian INOVA 750 # _atom_sites.entry_id 1PWJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_