data_1Q59 # _entry.id 1Q59 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.355 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1Q59 pdb_00001q59 10.2210/pdb1q59/pdb RCSB RCSB019932 ? ? WWPDB D_1000019932 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q59 _pdbx_database_status.recvd_initial_deposition_date 2003-08-06 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, Q.' 1 'Petros, A.M.' 2 'Virgin, H.W.' 3 'Fesik, S.W.' 4 'Olejniczak, E.T.' 5 # _citation.id primary _citation.title 'Solution Structure of the BHRF1 Protein From Epstein-Barr Virus, a Homolog of Human Bcl-2' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 332 _citation.page_first 1123 _citation.page_last 1130 _citation.year 2003 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14499614 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2003.08.007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, Q.' 1 ? primary 'Petros, A.M.' 2 ? primary 'Virgin, H.W.' 3 ? primary 'Fesik, S.W.' 4 ? primary 'Olejniczak, E.T.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Early antigen protein R' _entity.formula_weight 19848.254 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'BH1 and BH2 domains' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'BHRF1, EA-R, Nuclear antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG DDDDLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG DDDDLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 TYR n 1 4 SER n 1 5 THR n 1 6 ARG n 1 7 GLU n 1 8 ILE n 1 9 LEU n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 CYS n 1 14 ILE n 1 15 ARG n 1 16 ASP n 1 17 SER n 1 18 ARG n 1 19 VAL n 1 20 HIS n 1 21 GLY n 1 22 ASN n 1 23 GLY n 1 24 THR n 1 25 LEU n 1 26 HIS n 1 27 PRO n 1 28 VAL n 1 29 LEU n 1 30 GLU n 1 31 LEU n 1 32 ALA n 1 33 ALA n 1 34 ARG n 1 35 GLU n 1 36 THR n 1 37 PRO n 1 38 LEU n 1 39 ARG n 1 40 LEU n 1 41 SER n 1 42 PRO n 1 43 GLU n 1 44 ASP n 1 45 THR n 1 46 VAL n 1 47 VAL n 1 48 LEU n 1 49 ARG n 1 50 TYR n 1 51 HIS n 1 52 VAL n 1 53 LEU n 1 54 LEU n 1 55 GLU n 1 56 GLU n 1 57 ILE n 1 58 ILE n 1 59 GLU n 1 60 ARG n 1 61 ASN n 1 62 SER n 1 63 GLU n 1 64 THR n 1 65 PHE n 1 66 THR n 1 67 GLU n 1 68 THR n 1 69 TRP n 1 70 ASN n 1 71 ARG n 1 72 PHE n 1 73 ILE n 1 74 THR n 1 75 HIS n 1 76 THR n 1 77 GLU n 1 78 HIS n 1 79 VAL n 1 80 ASP n 1 81 LEU n 1 82 ASP n 1 83 PHE n 1 84 ASN n 1 85 SER n 1 86 VAL n 1 87 PHE n 1 88 LEU n 1 89 GLU n 1 90 ILE n 1 91 PHE n 1 92 HIS n 1 93 ARG n 1 94 GLY n 1 95 ASP n 1 96 PRO n 1 97 SER n 1 98 LEU n 1 99 GLY n 1 100 ARG n 1 101 ALA n 1 102 LEU n 1 103 ALA n 1 104 TRP n 1 105 MET n 1 106 ALA n 1 107 TRP n 1 108 CYS n 1 109 MET n 1 110 HIS n 1 111 ALA n 1 112 CYS n 1 113 ARG n 1 114 THR n 1 115 LEU n 1 116 CYS n 1 117 CYS n 1 118 ASN n 1 119 GLN n 1 120 SER n 1 121 THR n 1 122 PRO n 1 123 TYR n 1 124 TYR n 1 125 VAL n 1 126 VAL n 1 127 ASP n 1 128 LEU n 1 129 SER n 1 130 VAL n 1 131 ARG n 1 132 GLY n 1 133 MET n 1 134 LEU n 1 135 GLU n 1 136 ALA n 1 137 SER n 1 138 GLU n 1 139 GLY n 1 140 LEU n 1 141 ASP n 1 142 GLY n 1 143 TRP n 1 144 ILE n 1 145 HIS n 1 146 GLN n 1 147 GLN n 1 148 GLY n 1 149 GLY n 1 150 TRP n 1 151 SER n 1 152 THR n 1 153 LEU n 1 154 ILE n 1 155 GLU n 1 156 ASP n 1 157 ASN n 1 158 ILE n 1 159 PRO n 1 160 GLY n 1 161 ASP n 1 162 ASP n 1 163 ASP n 1 164 ASP n 1 165 LEU n 1 166 GLU n 1 167 HIS n 1 168 HIS n 1 169 HIS n 1 170 HIS n 1 171 HIS n 1 172 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Epstein-Barr virus' _entity_src_gen.gene_src_genus Lymphocryptovirus _entity_src_gen.pdbx_gene_src_gene BHRF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain GD1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human herpesvirus 4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10376 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EAR_EBV _struct_ref.pdbx_db_accession P03182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q59 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03182 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 160 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1Q59 ASP A 161 ? UNP P03182 ? ? 'cloning artifact' 161 1 1 1Q59 ASP A 162 ? UNP P03182 ? ? 'cloning artifact' 162 2 1 1Q59 ASP A 163 ? UNP P03182 ? ? 'cloning artifact' 163 3 1 1Q59 ASP A 164 ? UNP P03182 ? ? 'cloning artifact' 164 4 1 1Q59 LEU A 165 ? UNP P03182 ? ? 'cloning artifact' 165 5 1 1Q59 GLU A 166 ? UNP P03182 ? ? 'cloning artifact' 166 6 1 1Q59 HIS A 167 ? UNP P03182 ? ? 'cloning artifact' 167 7 1 1Q59 HIS A 168 ? UNP P03182 ? ? 'cloning artifact' 168 8 1 1Q59 HIS A 169 ? UNP P03182 ? ? 'cloning artifact' 169 9 1 1Q59 HIS A 170 ? UNP P03182 ? ? 'cloning artifact' 170 10 1 1Q59 HIS A 171 ? UNP P03182 ? ? 'cloning artifact' 171 11 1 1Q59 HIS A 172 ? UNP P03182 ? ? 'cloning artifact' 172 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'U-15N,13C 0.5-1.0 mM BHRF1-EBV-BCL2 , containing 20 mM Tris (pH 7.5) and 2 mM 2H-dithiothreitol' _pdbx_nmr_sample_details.solvent_system '90% H2O/10%2H2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker DRX 500 2 ? Bruker DRX 800 3 ? Bruker DRX 600 # _pdbx_nmr_refine.entry_id 1Q59 _pdbx_nmr_refine.method 'BHRF1 structures were calculated using a simulated annealing protocol with the program CNX' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 1Q59 _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _pdbx_nmr_representative.entry_id 1Q59 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # _pdbx_nmr_software.name CNS _pdbx_nmr_software.version 2000 _pdbx_nmr_software.classification refinement _pdbx_nmr_software.authors ? _pdbx_nmr_software.ordinal 1 # _exptl.entry_id 1Q59 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 1Q59 _struct.title 'Solution Structure of the BHRF1 Protein From Epstein-Barr Virus, a Homolog of Human Bcl-2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 1Q59 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'BHRF1, Bcl-2, Epstein-Barr Virus, NMR spectroscopy, Structure determination, Viral protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 7 ? VAL A 19 ? GLU A 7 VAL A 19 1 ? 13 HELX_P HELX_P2 2 ASP A 44 ? ASN A 61 ? ASP A 44 ASN A 61 1 ? 18 HELX_P HELX_P3 3 ASN A 61 ? ILE A 73 ? ASN A 61 ILE A 73 1 ? 13 HELX_P HELX_P4 4 ASP A 80 ? ILE A 90 ? ASP A 80 ILE A 90 1 ? 11 HELX_P HELX_P5 5 LEU A 98 ? ASN A 118 ? LEU A 98 ASN A 118 1 ? 21 HELX_P HELX_P6 6 THR A 121 ? GLU A 138 ? THR A 121 GLU A 138 1 ? 18 HELX_P HELX_P7 7 GLY A 139 ? GLN A 146 ? GLY A 139 GLN A 146 1 ? 8 HELX_P HELX_P8 8 THR A 152 ? ASN A 157 ? THR A 152 ASN A 157 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 1Q59 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Q59 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 TRP 69 69 69 TRP TRP A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 TYR 123 123 123 TYR TYR A . n A 1 124 TYR 124 124 124 TYR TYR A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 MET 133 133 133 MET MET A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 TRP 150 150 150 TRP TRP A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 HIS 168 168 168 HIS HIS A . n A 1 169 HIS 169 169 169 HIS HIS A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 HIS 171 171 171 HIS HIS A . n A 1 172 HIS 172 172 172 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-09-23 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-02 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LEU 140 ? ? H A ILE 144 ? ? 1.56 2 1 O A LEU 153 ? ? H A GLU 155 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 22 ? ? -54.52 106.20 2 1 PRO A 27 ? ? -64.53 11.59 3 1 VAL A 28 ? ? -92.58 35.66 4 1 LEU A 29 ? ? 158.30 46.06 5 1 ALA A 33 ? ? -177.13 90.54 6 1 ARG A 34 ? ? 171.71 106.45 7 1 ARG A 39 ? ? -56.82 105.74 8 1 PRO A 42 ? ? -66.99 63.04 9 1 GLU A 43 ? ? -151.94 26.21 10 1 ASP A 44 ? ? -56.17 -175.64 11 1 VAL A 52 ? ? -74.49 -70.65 12 1 ASN A 61 ? ? -110.77 55.48 13 1 ILE A 73 ? ? -37.34 153.01 14 1 THR A 74 ? ? 95.03 56.96 15 1 HIS A 78 ? ? -161.85 35.33 16 1 ASP A 95 ? ? 171.25 -53.67 17 1 PRO A 96 ? ? -47.31 172.95 18 1 ALA A 106 ? ? -77.34 -70.22 19 1 GLN A 119 ? ? -69.85 65.59 20 1 PRO A 122 ? ? -28.56 -171.20 21 1 ASP A 141 ? ? -41.10 -74.43 22 1 ILE A 154 ? ? -65.33 40.40 23 1 GLU A 155 ? ? -161.75 -80.27 24 1 ILE A 158 ? ? 65.08 128.96 25 1 ASP A 161 ? ? 176.84 47.48 26 1 ASP A 163 ? ? -175.95 -47.80 27 1 ASP A 164 ? ? 53.02 -163.46 28 1 LEU A 165 ? ? -147.37 57.46 29 1 HIS A 167 ? ? -179.49 -56.16 30 1 HIS A 168 ? ? -103.03 -164.43 31 1 HIS A 169 ? ? -154.68 37.57 #