data_1Q8H # _entry.id 1Q8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.304 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1Q8H RCSB RCSB020048 WWPDB D_1000020048 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1Q8H _pdbx_database_status.recvd_initial_deposition_date 2003-08-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hoang, Q.Q.' 1 'Sicheri, F.' 2 'Howard, A.J.' 3 'Yang, D.S.' 4 # _citation.id primary _citation.title 'Bone recognition mechanism of porcine osteocalcin from crystal structure.' _citation.journal_abbrev Nature _citation.journal_volume 425 _citation.page_first 977 _citation.page_last 980 _citation.year 2003 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 14586470 _citation.pdbx_database_id_DOI 10.1038/nature02079 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hoang, Q.Q.' 1 ? primary 'Sicheri, F.' 2 ? primary 'Howard, A.J.' 3 ? primary 'Yang, D.S.' 4 ? # _cell.entry_id 1Q8H _cell.length_a 51.491 _cell.length_b 51.491 _cell.length_c 35.389 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 1Q8H _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat Osteocalcin 5729.201 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 3 water nat water 18.015 61 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Bone Gla protein,BGP,Gamma-carboxyglutamic acid-containing protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'YLDHGLGAPAPYPDPL(CGU)PRR(CGU)VC(CGU)LNPDCDELADHIGFQEAYRRFYGIA' _entity_poly.pdbx_seq_one_letter_code_can YLDHGLGAPAPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGIA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 LEU n 1 3 ASP n 1 4 HIS n 1 5 GLY n 1 6 LEU n 1 7 GLY n 1 8 ALA n 1 9 PRO n 1 10 ALA n 1 11 PRO n 1 12 TYR n 1 13 PRO n 1 14 ASP n 1 15 PRO n 1 16 LEU n 1 17 CGU n 1 18 PRO n 1 19 ARG n 1 20 ARG n 1 21 CGU n 1 22 VAL n 1 23 CYS n 1 24 CGU n 1 25 LEU n 1 26 ASN n 1 27 PRO n 1 28 ASP n 1 29 CYS n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 ALA n 1 34 ASP n 1 35 HIS n 1 36 ILE n 1 37 GLY n 1 38 PHE n 1 39 GLN n 1 40 GLU n 1 41 ALA n 1 42 TYR n 1 43 ARG n 1 44 ARG n 1 45 PHE n 1 46 TYR n 1 47 GLY n 1 48 ILE n 1 49 ALA n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 49 _entity_src_nat.common_name Pig _entity_src_nat.pdbx_organism_scientific 'Sus scrofa' _entity_src_nat.pdbx_ncbi_taxonomy_id 9823 _entity_src_nat.genus Sus _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code OSTCN_PIG _struct_ref.pdbx_db_accession Q8HYY9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YLDHGLGAPAPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGIA _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1Q8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8HYY9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 49 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 49 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CGU 'L-peptide linking' n 'GAMMA-CARBOXY-GLUTAMIC ACID' ? 'C6 H9 N O6' 191.139 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1Q8H _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_percent_sol 47.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_details 'PEG 4000, Calcium Chloride, HEPES, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.7 # _reflns.entry_id 1Q8H _reflns.observed_criterion_sigma_I 2 _reflns.observed_criterion_sigma_F 2 _reflns.d_resolution_low 30.0 _reflns.d_resolution_high 2 _reflns.number_obs 6230 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.049 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 17.6 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2 _reflns_shell.d_res_low 2.07 _reflns_shell.percent_possible_all 94.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.214 _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1Q8H _refine.ls_number_reflns_obs 6230 _refine.ls_number_reflns_all 6783 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 3.00 _refine.pdbx_data_cutoff_high_absF 462281.14 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.72 _refine.ls_d_res_high 2.00 _refine.ls_percent_reflns_obs 87.7 _refine.ls_R_factor_obs 0.255 _refine.ls_R_factor_all 0.272 _refine.ls_R_factor_R_work 0.255 _refine.ls_R_factor_R_free 0.283 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 15.2 _refine.ls_number_reflns_R_free 948 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 37.1 _refine.aniso_B[1][1] 2.05 _refine.aniso_B[2][2] 2.05 _refine.aniso_B[3][3] -4.10 _refine.aniso_B[1][2] 3.91 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.349568 _refine.solvent_model_param_bsol 32.3123 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ISAS _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_overall_phase_error ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1Q8H _refine_analyze.Luzzati_coordinate_error_obs 0.31 _refine_analyze.Luzzati_sigma_a_obs 0.27 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.36 _refine_analyze.Luzzati_sigma_a_free 0.35 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 314 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 61 _refine_hist.number_atoms_total 378 _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 27.72 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 20.5 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.99 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.00 _refine_ls_shell.d_res_low 2.13 _refine_ls_shell.number_reflns_R_work 704 _refine_ls_shell.R_factor_R_work 0.306 _refine_ls_shell.percent_reflns_obs 68.6 _refine_ls_shell.R_factor_R_free 0.4 _refine_ls_shell.R_factor_R_free_error 0.039 _refine_ls_shell.percent_reflns_R_free 12.9 _refine_ls_shell.number_reflns_R_free 104 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 4 ION.PARAM ION.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1Q8H _struct.title 'Crystal structure of porcine osteocalcin' _struct.pdbx_descriptor osteocalcin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1Q8H _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text ;helix-turn-helix-turn-helix, Paper-clip, hydroxyapatite crystal surface binding protein, calcium binding protein, bone gla protein, METAL BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 16 ? ASN A 26 ? LEU A 16 ASN A 26 1 ? 11 HELX_P HELX_P2 2 ASN A 26 ? GLY A 37 ? ASN A 26 GLY A 37 1 ? 12 HELX_P HELX_P3 3 GLY A 37 ? GLY A 47 ? GLY A 37 GLY A 47 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 23 A CYS 29 1_555 ? ? ? ? ? ? ? 2.037 ? covale1 covale ? ? A LEU 16 C ? ? ? 1_555 A CGU 17 N ? ? A LEU 16 A CGU 17 1_555 ? ? ? ? ? ? ? 1.332 ? covale2 covale ? ? A CGU 17 C ? ? ? 1_555 A PRO 18 N ? ? A CGU 17 A PRO 18 1_555 ? ? ? ? ? ? ? 1.341 ? covale3 covale ? ? A ARG 20 C ? ? ? 1_555 A CGU 21 N ? ? A ARG 20 A CGU 21 1_555 ? ? ? ? ? ? ? 1.336 ? covale4 covale ? ? A CGU 21 C ? ? ? 1_555 A VAL 22 N ? ? A CGU 21 A VAL 22 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A CYS 23 C ? ? ? 1_555 A CGU 24 N ? ? A CYS 23 A CGU 24 1_555 ? ? ? ? ? ? ? 1.334 ? covale6 covale ? ? A CGU 24 C ? ? ? 1_555 A LEU 25 N ? ? A CGU 24 A LEU 25 1_555 ? ? ? ? ? ? ? 1.328 ? metalc1 metalc ? ? B CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 71 A HOH 87 1_555 ? ? ? ? ? ? ? 2.573 ? metalc2 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 24 OE11 ? ? A CA 71 A CGU 24 1_555 ? ? ? ? ? ? ? 2.450 ? metalc3 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 24 OE22 ? ? A CA 71 A CGU 24 1_555 ? ? ? ? ? ? ? 2.536 ? metalc4 metalc ? ? C CA . CA ? ? ? 1_555 A CGU 24 OE11 ? ? A CA 72 A CGU 24 1_555 ? ? ? ? ? ? ? 2.329 ? metalc5 metalc ? ? C CA . CA ? ? ? 1_555 A ASP 30 OD1 ? ? A CA 72 A ASP 30 1_555 ? ? ? ? ? ? ? 2.495 ? metalc6 metalc ? ? C CA . CA ? ? ? 1_555 A CGU 24 OE12 ? ? A CA 72 A CGU 24 1_555 ? ? ? ? ? ? ? 2.718 ? metalc7 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 118 1_555 ? ? ? ? ? ? ? 2.391 ? metalc8 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 97 1_555 ? ? ? ? ? ? ? 2.646 ? metalc9 metalc ? ? C CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 72 A HOH 88 1_555 ? ? ? ? ? ? ? 2.082 ? metalc10 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 24 OE21 ? ? A CA 73 A CGU 24 1_555 ? ? ? ? ? ? ? 2.976 ? metalc11 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 24 OE22 ? ? A CA 73 A CGU 24 1_555 ? ? ? ? ? ? ? 2.518 ? metalc12 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 73 A HOH 93 1_555 ? ? ? ? ? ? ? 2.370 ? metalc13 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 21 OE11 ? ? A CA 73 A CGU 21 1_555 ? ? ? ? ? ? ? 2.822 ? metalc14 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 21 OE11 ? ? A CA 71 A CGU 21 4_557 ? ? ? ? ? ? ? 2.131 ? metalc15 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 21 OE22 ? ? A CA 71 A CGU 21 4_557 ? ? ? ? ? ? ? 2.982 ? metalc16 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 17 OE22 ? ? A CA 71 A CGU 17 4_557 ? ? ? ? ? ? ? 2.366 ? metalc17 metalc ? ? B CA . CA ? ? ? 1_555 A CGU 17 OE12 ? ? A CA 71 A CGU 17 4_557 ? ? ? ? ? ? ? 2.582 ? metalc18 metalc ? ? C CA . CA ? ? ? 1_555 A CGU 17 OE22 ? ? A CA 72 A CGU 17 4_557 ? ? ? ? ? ? ? 2.375 ? metalc19 metalc ? ? C CA . CA ? ? ? 1_555 A CGU 17 OE21 ? ? A CA 72 A CGU 17 4_557 ? ? ? ? ? ? ? 3.153 ? metalc20 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 21 OE11 ? ? A CA 73 A CGU 21 4_557 ? ? ? ? ? ? ? 2.765 ? metalc21 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 24 OE21 ? ? A CA 73 A CGU 24 4_557 ? ? ? ? ? ? ? 2.947 ? metalc22 metalc ? ? D CA . CA ? ? ? 1_555 A CGU 24 OE22 ? ? A CA 73 A CGU 24 4_557 ? ? ? ? ? ? ? 2.531 ? metalc23 metalc ? ? D CA . CA ? ? ? 1_555 E HOH . O ? ? A CA 73 A HOH 93 4_557 ? ? ? ? ? ? ? 2.335 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA A 71' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 72' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 73' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CGU A 17 ? CGU A 17 . ? 4_557 ? 2 AC1 4 CGU A 21 ? CGU A 21 . ? 4_557 ? 3 AC1 4 CGU A 24 ? CGU A 24 . ? 1_555 ? 4 AC1 4 HOH E . ? HOH A 87 . ? 1_555 ? 5 AC2 6 CGU A 17 ? CGU A 17 . ? 4_557 ? 6 AC2 6 CGU A 24 ? CGU A 24 . ? 1_555 ? 7 AC2 6 ASP A 30 ? ASP A 30 . ? 1_555 ? 8 AC2 6 HOH E . ? HOH A 88 . ? 1_555 ? 9 AC2 6 HOH E . ? HOH A 97 . ? 1_555 ? 10 AC2 6 HOH E . ? HOH A 118 . ? 1_555 ? 11 AC3 6 CGU A 21 ? CGU A 21 . ? 1_555 ? 12 AC3 6 CGU A 21 ? CGU A 21 . ? 4_557 ? 13 AC3 6 CGU A 24 ? CGU A 24 . ? 1_555 ? 14 AC3 6 CGU A 24 ? CGU A 24 . ? 4_557 ? 15 AC3 6 HOH E . ? HOH A 93 . ? 4_557 ? 16 AC3 6 HOH E . ? HOH A 93 . ? 1_555 ? # _database_PDB_matrix.entry_id 1Q8H _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1Q8H _atom_sites.fract_transf_matrix[1][1] 0.019421 _atom_sites.fract_transf_matrix[1][2] 0.011213 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022425 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.028257 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 ? ? ? A . n A 1 2 LEU 2 2 ? ? ? A . n A 1 3 ASP 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 GLY 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 GLY 7 7 ? ? ? A . n A 1 8 ALA 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 PRO 11 11 ? ? ? A . n A 1 12 TYR 12 12 ? ? ? A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 CGU 17 17 17 CGU CGU A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CGU 21 21 21 CGU CGU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 CGU 24 24 24 CGU CGU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 ALA 49 49 49 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 71 71 CA CA A . C 2 CA 1 72 72 CA CA A . D 2 CA 1 73 73 CA CA A . E 3 HOH 1 74 1 HOH HOH A . E 3 HOH 2 75 2 HOH HOH A . E 3 HOH 3 76 3 HOH HOH A . E 3 HOH 4 77 4 HOH HOH A . E 3 HOH 5 78 5 HOH HOH A . E 3 HOH 6 79 6 HOH HOH A . E 3 HOH 7 80 7 HOH HOH A . E 3 HOH 8 81 8 HOH HOH A . E 3 HOH 9 82 9 HOH HOH A . E 3 HOH 10 83 10 HOH HOH A . E 3 HOH 11 84 11 HOH HOH A . E 3 HOH 12 85 12 HOH HOH A . E 3 HOH 13 86 13 HOH HOH A . E 3 HOH 14 87 14 HOH HOH A . E 3 HOH 15 88 15 HOH HOH A . E 3 HOH 16 89 16 HOH HOH A . E 3 HOH 17 90 17 HOH HOH A . E 3 HOH 18 91 18 HOH HOH A . E 3 HOH 19 92 19 HOH HOH A . E 3 HOH 20 93 20 HOH HOH A . E 3 HOH 21 94 21 HOH HOH A . E 3 HOH 22 95 22 HOH HOH A . E 3 HOH 23 96 23 HOH HOH A . E 3 HOH 24 97 24 HOH HOH A . E 3 HOH 25 98 25 HOH HOH A . E 3 HOH 26 99 26 HOH HOH A . E 3 HOH 27 100 27 HOH HOH A . E 3 HOH 28 101 28 HOH HOH A . E 3 HOH 29 102 29 HOH HOH A . E 3 HOH 30 103 30 HOH HOH A . E 3 HOH 31 104 31 HOH HOH A . E 3 HOH 32 105 33 HOH HOH A . E 3 HOH 33 106 34 HOH HOH A . E 3 HOH 34 107 35 HOH HOH A . E 3 HOH 35 108 36 HOH HOH A . E 3 HOH 36 109 37 HOH HOH A . E 3 HOH 37 110 38 HOH HOH A . E 3 HOH 38 111 39 HOH HOH A . E 3 HOH 39 112 40 HOH HOH A . E 3 HOH 40 113 41 HOH HOH A . E 3 HOH 41 114 42 HOH HOH A . E 3 HOH 42 115 43 HOH HOH A . E 3 HOH 43 116 44 HOH HOH A . E 3 HOH 44 117 45 HOH HOH A . E 3 HOH 45 118 46 HOH HOH A . E 3 HOH 46 119 47 HOH HOH A . E 3 HOH 47 120 48 HOH HOH A . E 3 HOH 48 121 49 HOH HOH A . E 3 HOH 49 122 50 HOH HOH A . E 3 HOH 50 123 51 HOH HOH A . E 3 HOH 51 124 52 HOH HOH A . E 3 HOH 52 125 53 HOH HOH A . E 3 HOH 53 126 54 HOH HOH A . E 3 HOH 54 127 55 HOH HOH A . E 3 HOH 55 128 56 HOH HOH A . E 3 HOH 56 129 57 HOH HOH A . E 3 HOH 57 130 58 HOH HOH A . E 3 HOH 58 131 59 HOH HOH A . E 3 HOH 59 132 60 HOH HOH A . E 3 HOH 60 133 63 HOH HOH A . E 3 HOH 61 134 64 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CGU 17 A CGU 17 ? GLU 'modified residue' 2 A CGU 21 A CGU 21 ? GLU 'modified residue' 3 A CGU 24 A CGU 24 ? GLU 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1250 ? 1 MORE -70 ? 1 'SSA (A^2)' 5320 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_557 y,x,-z+2 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 70.7780000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CA _pdbx_struct_special_symmetry.auth_seq_id 73 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id CA _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 84.0 ? 2 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 99.5 ? 3 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 70.9 ? 4 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 82.1 ? 5 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 141.1 ? 6 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 75.9 ? 7 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 70.5 ? 8 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 135.1 ? 9 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 147.6 ? 10 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 72.3 ? 11 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 130.7 ? 12 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 74.1 ? 13 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 113.3 ? 14 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 139.6 ? 15 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 95.0 ? 16 O ? E HOH . ? A HOH 87 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 152.5 ? 17 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 123.4 ? 18 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 88.6 ? 19 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 74.3 ? 20 OE22 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 88.6 ? 21 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? B CA . ? A CA 71 ? 1_555 OE12 ? A CGU 17 ? A CGU 17 ? 4_557 67.0 ? 22 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 94.2 ? 23 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 50.9 ? 24 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 79.8 ? 25 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 127.0 ? 26 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 64.5 ? 27 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 118 ? 1_555 76.9 ? 28 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 159.1 ? 29 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 92.6 ? 30 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 150.0 ? 31 O ? E HOH . ? A HOH 118 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 97 ? 1_555 73.6 ? 32 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 77.8 ? 33 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 73.6 ? 34 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 119.5 ? 35 O ? E HOH . ? A HOH 118 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 131.4 ? 36 O ? E HOH . ? A HOH 97 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 O ? E HOH . ? A HOH 88 ? 1_555 85.2 ? 37 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 76.2 ? 38 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 158.1 ? 39 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 107.4 ? 40 O ? E HOH . ? A HOH 118 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 136.8 ? 41 O ? E HOH . ? A HOH 97 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 90.4 ? 42 O ? E HOH . ? A HOH 88 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 85.1 ? 43 OE11 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 119.5 ? 44 OD1 ? A ASP 30 ? A ASP 30 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 141.2 ? 45 OE12 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 135.7 ? 46 O ? E HOH . ? A HOH 118 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 103.3 ? 47 O ? E HOH . ? A HOH 97 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 49.1 ? 48 O ? E HOH . ? A HOH 88 ? 1_555 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 94.0 ? 49 OE22 ? A CGU 17 ? A CGU 17 ? 4_557 CA ? C CA . ? A CA 72 ? 1_555 OE21 ? A CGU 17 ? A CGU 17 ? 4_557 43.3 ? 50 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 45.5 ? 51 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 63.8 ? 52 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 1_555 69.9 ? 53 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 74.8 ? 54 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 119.3 ? 55 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 75.4 ? 56 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 98.8 ? 57 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 66.1 ? 58 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 129.9 ? 59 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 148.8 ? 60 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 157.7 ? 61 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 140.9 ? 62 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 135.8 ? 63 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 98.2 ? 64 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 76.1 ? 65 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 138.5 ? 66 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 161.0 ? 67 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 95.1 ? 68 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 65.1 ? 69 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 121.0 ? 70 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 45.8 ? 71 OE21 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 136.1 ? 72 OE22 ? A CGU 24 ? A CGU 24 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 96.3 ? 73 O ? E HOH . ? A HOH 93 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 85.4 ? 74 OE11 ? A CGU 21 ? A CGU 21 ? 1_555 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 128.8 ? 75 OE11 ? A CGU 21 ? A CGU 21 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 77.0 ? 76 OE21 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 64.6 ? 77 OE22 ? A CGU 24 ? A CGU 24 ? 4_557 CA ? D CA . ? A CA 73 ? 1_555 O ? E HOH . ? A HOH 93 ? 4_557 70.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2003-11-11 2 'Structure model' 1 1 2008-04-29 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-11 5 'Structure model' 2 0 2019-02-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Atomic model' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Source and taxonomy' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' entity 5 5 'Structure model' entity_name_com 6 5 'Structure model' entity_src_nat 7 5 'Structure model' pdbx_struct_mod_residue 8 5 'Structure model' struct_ref 9 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_software.classification' 2 4 'Structure model' '_software.name' 3 5 'Structure model' '_atom_site.occupancy' 4 5 'Structure model' '_entity.pdbx_description' 5 5 'Structure model' '_entity_src_nat.common_name' 6 5 'Structure model' '_entity_src_nat.pdbx_beg_seq_num' 7 5 'Structure model' '_entity_src_nat.pdbx_end_seq_num' 8 5 'Structure model' '_pdbx_struct_mod_residue.details' 9 5 'Structure model' '_struct_ref.db_code' 10 5 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 MAR345 'data collection' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 117 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 117 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_556 _pdbx_validate_symm_contact.dist 1.80 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 1 ? A TYR 1 2 1 Y 1 A LEU 2 ? A LEU 2 3 1 Y 1 A ASP 3 ? A ASP 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A GLY 5 ? A GLY 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A GLY 7 ? A GLY 7 8 1 Y 1 A ALA 8 ? A ALA 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A PRO 11 ? A PRO 11 12 1 Y 1 A TYR 12 ? A TYR 12 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH #