data_1QA4 # _entry.id 1QA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QA4 pdb_00001qa4 10.2210/pdb1qa4/pdb RCSB RCSB000835 ? ? WWPDB D_1000000835 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-05-26 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2021-10-27 6 'Structure model' 1 5 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Derived calculations' 8 5 'Structure model' 'Source and taxonomy' 9 5 'Structure model' 'Structure summary' 10 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_conn 6 5 'Structure model' database_2 7 5 'Structure model' entity 8 5 'Structure model' pdbx_entity_src_syn 9 5 'Structure model' pdbx_nmr_software 10 5 'Structure model' pdbx_nmr_spectrometer 11 5 'Structure model' struct_site 12 6 'Structure model' chem_comp_atom 13 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.page_last' 2 4 'Structure model' '_citation.pdbx_database_id_DOI' 3 4 'Structure model' '_citation.pdbx_database_id_PubMed' 4 4 'Structure model' '_citation.title' 5 4 'Structure model' '_citation_author.name' 6 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_entity.pdbx_description' 10 5 'Structure model' '_entity.pdbx_fragment' 11 5 'Structure model' '_pdbx_entity_src_syn.details' 12 5 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id' 13 5 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 14 5 'Structure model' '_pdbx_entity_src_syn.organism_scientific' 15 5 'Structure model' '_pdbx_nmr_software.authors' 16 5 'Structure model' '_pdbx_nmr_software.classification' 17 5 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 18 5 'Structure model' '_pdbx_nmr_spectrometer.model' 19 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QA4 _pdbx_database_status.recvd_initial_deposition_date 1999-04-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Geyer, M.' 1 'Kalbitzer, H.R.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the anchor-domain of myristoylated and non-myristoylated HIV-1 Nef protein.' J.Mol.Biol. 289 123 138 1999 JMOBAK UK 0022-2836 0070 ? 10339411 10.1006/jmbi.1999.2740 1 'Refined solution structure and backbone dynamics of HIV-1 Nef.' 'Protein Sci.' 6 1248 1263 1997 PRCIEI US 0961-8368 0795 ? 9194185 10.1002/pro.5560060613 2 'Solution structure of a polypeptide from the N terminus of the HIV protein Nef.' Biochemistry 36 5970 5980 1997 BICHAW US 0006-2960 0033 ? 9166767 10.1021/bi9629945 3 ;The crystal structure of HIV-1 Nef protein bound to the Fyn kinase SH3 domain suggests a role for this complex in altered T cell receptor signaling. ; Structure 5 1361 1372 1997 STRUE6 UK 0969-2126 2005 ? 9351809 '10.1016/s0969-2126(97)00286-4' 4 'Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain.' 'Cell(Cambridge,Mass.)' 85 931 942 1996 CELLB5 US 0092-8674 0998 ? 8681387 '10.1016/s0092-8674(00)81276-3' 5 ;The solution structure of HIV-1 Nef reveals an unexpected fold and permits delineation of the binding surface for the SH3 domain of Hck tyrosine protein kinase. ; Nat.Struct.Biol. 3 340 345 1996 NSBIEW US 1072-8368 2024 ? 8599760 10.1038/nsb0496-340 6 'A possible regulation of negative factor (Nef) activity of human immunodeficiency virus type 1 by the viral protease.' Eur.J.Biochem. 223 589 593 1994 EJBCAI IX 0014-2956 0262 ? 8055930 10.1111/j.1432-1033.1994.tb19029.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Geyer, M.' 1 ? primary 'Munte, C.E.' 2 ? primary 'Schorr, J.' 3 ? primary 'Kellner, R.' 4 ? primary 'Kalbitzer, H.R.' 5 ? 1 'Grzesiek, S.' 6 ? 1 'Bax, A.' 7 ? 1 'Hu, J.S.' 8 ? 1 'Kaufman, J.' 9 ? 1 'Palmer, I.' 10 ? 1 'Stahl, S.J.' 11 ? 1 'Tjandra, N.' 12 ? 1 'Wingfield, P.T.' 13 ? 2 'Barnham, K.J.' 14 ? 2 'Monks, S.A.' 15 ? 2 'Hinds, M.G.' 16 ? 2 'Azad, A.A.' 17 ? 2 'Norton, R.S.' 18 ? 3 'Arold, S.' 19 ? 3 'Franken, P.' 20 ? 3 'Strub, M.P.' 21 ? 3 'Hoh, F.' 22 ? 3 'Benichou, S.' 23 ? 3 'Benarous, R.' 24 ? 3 'Dumas, C.' 25 ? 4 'Lee, C.H.' 26 ? 4 'Saksela, K.' 27 ? 4 'Mirza, U.A.' 28 ? 4 'Chait, B.T.' 29 ? 4 'Kuriyan, J.' 30 ? 5 'Grzesiek, S.' 31 ? 5 'Bax, A.' 32 ? 5 'Clore, G.M.' 33 ? 5 'Gronenborn, A.M.' 34 ? 5 'Hu, J.S.' 35 ? 5 'Kaufman, J.' 36 ? 5 'Palmer, I.' 37 ? 5 'Stahl, S.J.' 38 ? 5 'Wingfield, P.T.' 39 ? 6 'Freund, J.' 40 ? 6 'Kellner, R.' 41 ? 6 'Konvalinka, J.' 42 ? 6 'Wolber, V.' 43 ? 6 'Krausslich, H.G.' 44 ? 6 'Kalbitzer, H.R.' 45 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Protein Nef' _entity.formula_weight 5817.458 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'ANCHOR DOMAIN, residues 2-57' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GGKWSKSSVVGWPAVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAANNAACAW(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GGKWSKSSVVGWPAVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAANNAACAWX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 LYS n 1 4 TRP n 1 5 SER n 1 6 LYS n 1 7 SER n 1 8 SER n 1 9 VAL n 1 10 VAL n 1 11 GLY n 1 12 TRP n 1 13 PRO n 1 14 ALA n 1 15 VAL n 1 16 ARG n 1 17 GLU n 1 18 ARG n 1 19 MET n 1 20 ARG n 1 21 ARG n 1 22 ALA n 1 23 GLU n 1 24 PRO n 1 25 ALA n 1 26 ALA n 1 27 ASP n 1 28 GLY n 1 29 VAL n 1 30 GLY n 1 31 ALA n 1 32 ALA n 1 33 SER n 1 34 ARG n 1 35 ASP n 1 36 LEU n 1 37 GLU n 1 38 LYS n 1 39 HIS n 1 40 GLY n 1 41 ALA n 1 42 ILE n 1 43 THR n 1 44 SER n 1 45 SER n 1 46 ASN n 1 47 THR n 1 48 ALA n 1 49 ALA n 1 50 ASN n 1 51 ASN n 1 52 ALA n 1 53 ALA n 1 54 CYS n 1 55 ALA n 1 56 TRP n 1 57 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Human immunodeficiency virus type 1 (isolate NL4-3)' _pdbx_entity_src_syn.organism_common_name HIV-1 _pdbx_entity_src_syn.ncbi_taxonomy_id 11676 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 2 2 GLY GLY A . n A 1 2 GLY 2 3 3 GLY GLY A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 TRP 4 5 5 TRP TRP A . n A 1 5 SER 5 6 6 SER SER A . n A 1 6 LYS 6 7 7 LYS LYS A . n A 1 7 SER 7 8 8 SER SER A . n A 1 8 SER 8 9 9 SER SER A . n A 1 9 VAL 9 10 10 VAL VAL A . n A 1 10 VAL 10 11 11 VAL VAL A . n A 1 11 GLY 11 12 12 GLY GLY A . n A 1 12 TRP 12 13 13 TRP TRP A . n A 1 13 PRO 13 14 14 PRO PRO A . n A 1 14 ALA 14 15 15 ALA ALA A . n A 1 15 VAL 15 16 16 VAL VAL A . n A 1 16 ARG 16 17 17 ARG ARG A . n A 1 17 GLU 17 18 18 GLU GLU A . n A 1 18 ARG 18 19 19 ARG ARG A . n A 1 19 MET 19 20 20 MET MET A . n A 1 20 ARG 20 21 21 ARG ARG A . n A 1 21 ARG 21 22 22 ARG ARG A . n A 1 22 ALA 22 23 23 ALA ALA A . n A 1 23 GLU 23 24 24 GLU GLU A . n A 1 24 PRO 24 25 25 PRO PRO A . n A 1 25 ALA 25 26 26 ALA ALA A . n A 1 26 ALA 26 27 27 ALA ALA A . n A 1 27 ASP 27 28 28 ASP ASP A . n A 1 28 GLY 28 29 29 GLY GLY A . n A 1 29 VAL 29 30 30 VAL VAL A . n A 1 30 GLY 30 31 31 GLY GLY A . n A 1 31 ALA 31 32 32 ALA ALA A . n A 1 32 ALA 32 33 33 ALA ALA A . n A 1 33 SER 33 34 34 SER SER A . n A 1 34 ARG 34 35 35 ARG ARG A . n A 1 35 ASP 35 36 36 ASP ASP A . n A 1 36 LEU 36 37 37 LEU LEU A . n A 1 37 GLU 37 38 38 GLU GLU A . n A 1 38 LYS 38 39 39 LYS LYS A . n A 1 39 HIS 39 40 40 HIS HIS A . n A 1 40 GLY 40 41 41 GLY GLY A . n A 1 41 ALA 41 42 42 ALA ALA A . n A 1 42 ILE 42 43 43 ILE ILE A . n A 1 43 THR 43 44 44 THR THR A . n A 1 44 SER 44 45 45 SER SER A . n A 1 45 SER 45 46 46 SER SER A . n A 1 46 ASN 46 47 47 ASN ASN A . n A 1 47 THR 47 48 48 THR THR A . n A 1 48 ALA 48 49 49 ALA ALA A . n A 1 49 ALA 49 50 50 ALA ALA A . n A 1 50 ASN 50 51 51 ASN ASN A . n A 1 51 ASN 51 52 52 ASN ASN A . n A 1 52 ALA 52 53 53 ALA ALA A . n A 1 53 ALA 53 54 54 ALA ALA A . n A 1 54 CYS 54 55 55 CYS CYS A . n A 1 55 ALA 55 56 56 ALA ALA A . n A 1 56 TRP 56 57 57 TRP TRP A . n A 1 57 NH2 57 58 57 NH2 TRP A . n # _cell.entry_id 1QA4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QA4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1QA4 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1QA4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1QA4 _struct.title 'HIV-1 NEF ANCHOR DOMAIN, NMR, 2 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QA4 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'HIV, AIDS, REGULATORY FACTOR, NEGATIVE FACTOR, NEF, MYRISTOYLATION, MYRISTYLATION, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEF_HV112 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04324 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04324 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 57 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 57 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id LEU _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 36 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 39 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id LEU _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 37 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 40 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id TRP _struct_conn.ptnr1_label_seq_id 56 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 57 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id TRP _struct_conn.ptnr1_auth_seq_id 57 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 58 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.329 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 58 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 58' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ALA A 55 ? ALA A 56 . ? 1_555 ? 2 AC1 2 TRP A 56 ? TRP A 57 . ? 1_555 ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 2 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 4 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HZ3 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 7 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 16 ? ? -128.24 -56.29 2 1 ARG A 17 ? ? 177.75 152.08 3 1 ALA A 42 ? ? -96.16 39.79 4 1 ASN A 51 ? ? 48.17 -163.27 5 1 ALA A 54 ? ? 72.95 152.36 6 2 VAL A 11 ? ? 72.52 158.05 7 2 ALA A 15 ? ? -105.33 51.46 8 2 VAL A 16 ? ? 70.99 -66.78 9 2 ARG A 17 ? ? 80.31 -45.48 10 2 ASP A 28 ? ? 64.65 -178.01 11 2 ARG A 35 ? ? -82.52 -82.38 12 2 ASP A 36 ? ? -95.27 -72.45 13 2 ALA A 49 ? ? 62.36 -174.48 14 2 ALA A 50 ? ? 63.77 -172.85 15 2 ASN A 52 ? ? 64.79 -178.45 16 2 ALA A 54 ? ? 67.73 -84.11 # _pdbx_nmr_ensemble.entry_id 1QA4 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 2 _pdbx_nmr_ensemble.conformer_selection_criteria ;TWO STRUCTURES WITH LOW TOTAL ENERGY WERE SELECTED SHOWING THE CONFORMATIONAL VARIETY OF THE FLEXIBLE DOMAIN ; _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1QA4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 285.0 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 1H _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_refine.entry_id 1QA4 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE STRUCTURES WERE CALCULATED WITH X-PLOR, V. 3.851 (BRUNGER, 1992) USING A DISTANCE GEOMETRY/SIMULATED ANNEALING PROTOCOL (NILGES ET AL., FEBS LETT. 229, 317 (1988)). ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure calculation' AURELIA 2.0 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 2 'structure calculation' X-PLOR 3.851 BRUNGER 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 NH2 N N N N 227 NH2 HN1 H N N 228 NH2 HN2 H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 MET N CA sing N N 197 MET N H sing N N 198 MET N H2 sing N N 199 MET CA C sing N N 200 MET CA CB sing N N 201 MET CA HA sing N N 202 MET C O doub N N 203 MET C OXT sing N N 204 MET CB CG sing N N 205 MET CB HB2 sing N N 206 MET CB HB3 sing N N 207 MET CG SD sing N N 208 MET CG HG2 sing N N 209 MET CG HG3 sing N N 210 MET SD CE sing N N 211 MET CE HE1 sing N N 212 MET CE HE2 sing N N 213 MET CE HE3 sing N N 214 MET OXT HXT sing N N 215 NH2 N HN1 sing N N 216 NH2 N HN2 sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TRP N CA sing N N 264 TRP N H sing N N 265 TRP N H2 sing N N 266 TRP CA C sing N N 267 TRP CA CB sing N N 268 TRP CA HA sing N N 269 TRP C O doub N N 270 TRP C OXT sing N N 271 TRP CB CG sing N N 272 TRP CB HB2 sing N N 273 TRP CB HB3 sing N N 274 TRP CG CD1 doub Y N 275 TRP CG CD2 sing Y N 276 TRP CD1 NE1 sing Y N 277 TRP CD1 HD1 sing N N 278 TRP CD2 CE2 doub Y N 279 TRP CD2 CE3 sing Y N 280 TRP NE1 CE2 sing Y N 281 TRP NE1 HE1 sing N N 282 TRP CE2 CZ2 sing Y N 283 TRP CE3 CZ3 doub Y N 284 TRP CE3 HE3 sing N N 285 TRP CZ2 CH2 doub Y N 286 TRP CZ2 HZ2 sing N N 287 TRP CZ3 CH2 sing Y N 288 TRP CZ3 HZ3 sing N N 289 TRP CH2 HH2 sing N N 290 TRP OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 500 ? 2 DMX Bruker 800 ? # _atom_sites.entry_id 1QA4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_