data_1QA5 # _entry.id 1QA5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QA5 pdb_00001qa5 10.2210/pdb1qa5/pdb RCSB RCSB000836 ? ? WWPDB D_1000000836 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QA5 _pdbx_database_status.recvd_initial_deposition_date 1999-04-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Geyer, M.' 1 'Kalbitzer, H.R.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of the anchor-domain of myristoylated and non-myristoylated HIV-1 Nef protein.' J.Mol.Biol. 289 123 138 1999 JMOBAK UK 0022-2836 0070 ? 10339411 10.1006/jmbi.1999.2740 1 'Refined solution structure and backbone dynamics of HIV-1 Nef.' 'Protein Sci.' 6 1248 1263 1997 PRCIEI US 0961-8368 0795 ? 9194185 10.1002/pro.5560060613 2 'Solution structure of a polypeptide from the N terminus of the HIV protein Nef.' Biochemistry 36 5970 5980 1997 BICHAW US 0006-2960 0033 ? 9166767 10.1021/bi9629945 3 ;The crystal structure of HIV-1 Nef protein bound to the Fyn kinase SH3 domain suggests a role for this complex in altered T cell receptor signaling. ; Structure 5 1361 1372 1997 STRUE6 UK 0969-2126 2005 ? 9351809 '10.1016/s0969-2126(97)00286-4' 4 'Crystal structure of the conserved core of HIV-1 Nef complexed with a Src family SH3 domain.' 'Cell(Cambridge,Mass.)' 85 931 942 1996 CELLB5 US 0092-8674 0998 ? 8681387 '10.1016/s0092-8674(00)81276-3' 5 ;The solution structure of HIV-1 Nef reveals an unexpected fold and permits delineation of the binding surface for the SH3 domain of Hck tyrosine protein kinase. ; Nat.Struct.Biol. 3 340 345 1996 NSBIEW US 1072-8368 2024 ? 8599760 10.1038/nsb0496-340 6 'A possible regulation of negative factor (Nef) activity of human immunodeficiency virus type 1 by the viral protease.' Eur.J.Biochem. 223 589 593 1994 EJBCAI IX 0014-2956 0262 ? 8055930 10.1111/j.1432-1033.1994.tb19029.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Geyer, M.' 1 ? primary 'Munte, C.E.' 2 ? primary 'Schorr, J.' 3 ? primary 'Kellner, R.' 4 ? primary 'Kalbitzer, H.R.' 5 ? 1 'Grzesiek, S.' 6 ? 1 'Bax, A.' 7 ? 1 'Hu, J.S.' 8 ? 1 'Kaufman, J.' 9 ? 1 'Palmer, I.' 10 ? 1 'Stahl, S.J.' 11 ? 1 'Tjandra, N.' 12 ? 1 'Wingfield, P.T.' 13 ? 2 'Barnham, K.J.' 14 ? 2 'Monks, S.A.' 15 ? 2 'Hinds, M.G.' 16 ? 2 'Azad, A.A.' 17 ? 2 'Norton, R.S.' 18 ? 3 'Arold, S.' 19 ? 3 'Franken, P.' 20 ? 3 'Strub, M.P.' 21 ? 3 'Hoh, F.' 22 ? 3 'Benichou, S.' 23 ? 3 'Benarous, R.' 24 ? 3 'Dumas, C.' 25 ? 4 'Lee, C.H.' 26 ? 4 'Saksela, K.' 27 ? 4 'Mirza, U.A.' 28 ? 4 'Chait, B.T.' 29 ? 4 'Kuriyan, J.' 30 ? 5 'Grzesiek, S.' 31 ? 5 'Bax, A.' 32 ? 5 'Clore, G.M.' 33 ? 5 'Gronenborn, A.M.' 34 ? 5 'Hu, J.S.' 35 ? 5 'Kaufman, J.' 36 ? 5 'Palmer, I.' 37 ? 5 'Stahl, S.J.' 38 ? 5 'Wingfield, P.T.' 39 ? 6 'Freund, J.' 40 ? 6 'Kellner, R.' 41 ? 6 'Konvalinka, J.' 42 ? 6 'Wolber, V.' 43 ? 6 'Krausslich, H.G.' 44 ? 6 'Kalbitzer, H.R.' 45 ? # _cell.entry_id 1QA5 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QA5 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'PROTEIN (MYRISTOYLATED HIV-1 NEF ANCHOR DOMAIN (MYRISTATE-GLY2 TO TRP57))' _entity.formula_weight 6027.812 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_keywords.entity_id 1 _entity_keywords.text 'N-TERMINAL MYRISTOYLATION ON GLY-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(MYR)GGKWSKSSVVGWPAVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAANNAACAW(NH2)' _entity_poly.pdbx_seq_one_letter_code_can XGGKWSKSSVVGWPAVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAANNAACAWX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MYR n 1 2 GLY n 1 3 GLY n 1 4 LYS n 1 5 TRP n 1 6 SER n 1 7 LYS n 1 8 SER n 1 9 SER n 1 10 VAL n 1 11 VAL n 1 12 GLY n 1 13 TRP n 1 14 PRO n 1 15 ALA n 1 16 VAL n 1 17 ARG n 1 18 GLU n 1 19 ARG n 1 20 MET n 1 21 ARG n 1 22 ARG n 1 23 ALA n 1 24 GLU n 1 25 PRO n 1 26 ALA n 1 27 ALA n 1 28 ASP n 1 29 GLY n 1 30 VAL n 1 31 GLY n 1 32 ALA n 1 33 ALA n 1 34 SER n 1 35 ARG n 1 36 ASP n 1 37 LEU n 1 38 GLU n 1 39 LYS n 1 40 HIS n 1 41 GLY n 1 42 ALA n 1 43 ILE n 1 44 THR n 1 45 SER n 1 46 SER n 1 47 ASN n 1 48 THR n 1 49 ALA n 1 50 ALA n 1 51 ASN n 1 52 ASN n 1 53 ALA n 1 54 ALA n 1 55 CYS n 1 56 ALA n 1 57 TRP n 1 58 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Human immunodeficiency virus type 1 (isolate NL4-3)' _pdbx_entity_src_syn.organism_common_name HIV-1 _pdbx_entity_src_syn.ncbi_taxonomy_id 11676 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEF_HV112 _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P04324 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QA5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04324 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 57 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 57 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1QA5 MYR A 1 ? ? P04324 ? ? 'modified residue' 1 1 1 1QA5 NH2 A 58 ? ? P04324 ? ? amidation 58 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MYR non-polymer . 'MYRISTIC ACID' ? 'C14 H28 O2' 228.371 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type 1H _pdbx_nmr_exptl.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pH 4.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K _pdbx_nmr_exptl_sample_conditions.label ? _pdbx_nmr_exptl_sample_conditions.pH_units ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AMX Bruker 500 ? 2 DMX Bruker 800 ? # _pdbx_nmr_refine.entry_id 1QA5 _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details ;THE STRUCTURES WERE CALCULATED WITH X-PLOR, V. 3.851 (BRUNGER, 1992) USING A DISTANCE GEOMETRY/SIMULATED ANNEALING PROTOCOL (NILGES ET AL., FEBS LETT. 229, 317 (1988)). THE 3D STRUCTURE OF MYRISTOYLATED HIV-1 NEF ANCHOR DOMAIN (MYR-2-57) SOLVED BY TWO-DIMENSIONAL HOMONUCLEAR NMR SPECTROSCOPY IS BASED ON 540 EXPERIMENTAL RESTRAINTS: 332 INTRARESIDUAL, 156 SEQUENTIAL AND MEDIUM RANGE (1<=|I-J|<=4), AND 10 LONG RANGE (|I-J|>=5) INTERPROTON DISTANCE RESTRAINTS; 42 TORSION ANGLE RESTRAINTS (PHI). NO RESTRAINTS FOR HYDROGEN BONDS WERE ADDED. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 1QA5 _pdbx_nmr_details.text ;THE COORDINATES OF 2 SIMULATED ANNEALING STRUCTURES ARE PRESENTED IN THIS ENTRY. THE STRUCTURE OF THE MYRISTOYLATED HIV-1 NEF ANCHOR DOMAIN IS HIGHLY FLEXIBLE AND NOT WELL DEFINED BY NMR RESTRAINTS. ONLY TWO SECONDARY STRUCTURE ELEMENTS CAN BE OBSERVED: A FIRST HELIX IN THE POSITIVE CLUSTER REGION FROM PRO14 TO ARG22 AND A SECOND HELICAL REGION FROM ALA33 TO GLY41. ADDITIONALLY, THE N-TERMINAL MYRISTIC ACID RESIDUE CLOSELY INTERACTS WITH THE SIDE CHAIN OF TRP5 AND THEREBY FORMS A LOOP WITH GLY2, GLY3 AND LYS4 IN THE KINK REGION. TWO MODELS ARE PRESENTED TO DEMONSTRATE THE CONFORMATIONAL VARIETY OF THE STRUCTURES CALCULATED. ; # _pdbx_nmr_ensemble.entry_id 1QA5 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 2 _pdbx_nmr_ensemble.conformer_selection_criteria 'TWO STRUCTURES WITH LOW TOTAL ENERGY WERE SELECTED SHOWING THE CONFORMATIONAL VARIETY OF THE FLEXIBLE DOMAIN' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 1QA5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.851 BRUNGER 1 'structure calculation' AURELIA 2.0 'Neidig, Geyer, Gorler, Antz, Saffrich, Beneicke, Kalbitzer' 2 'structure calculation' X-PLOR 3.851 BRUNGER 3 # _exptl.entry_id 1QA5 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 1QA5 _struct.title 'MYRISTOYLATED HIV-1 NEF ANCHOR DOMAIN, NMR, 2 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QA5 _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'HIV, AIDS, REGULATORY FACTOR, NEGATIVE FACTOR, NEF, MYRISTOYLATION, Viral protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 16 ? ARG A 22 ? VAL A 16 ARG A 22 1 ? 7 HELX_P HELX_P2 2 LEU A 37 ? GLY A 41 ? LEU A 37 GLY A 41 1 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MYR 1 C1 ? ? ? 1_555 A GLY 2 N ? ? A MYR 1 A GLY 2 1_555 ? ? ? ? ? ? ? 1.314 ? ? covale2 covale both ? A TRP 57 C ? ? ? 1_555 A NH2 58 N ? ? A TRP 57 A NH2 58 1_555 ? ? ? ? ? ? ? 1.304 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 1QA5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QA5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MYR 1 1 1 MYR MYR A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 TRP 13 13 13 TRP TRP A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 NH2 58 58 57 NH2 TRP A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 310 ? 1 MORE 2 ? 1 'SSA (A^2)' 6460 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-05-26 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-11-27 5 'Structure model' 1 4 2021-10-27 6 'Structure model' 1 5 2022-12-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Source and taxonomy' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_assembly_prop 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_entity_src_syn 10 5 'Structure model' pdbx_nmr_software 11 5 'Structure model' pdbx_nmr_spectrometer 12 6 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.pdbx_database_id_DOI' 2 4 'Structure model' '_citation.pdbx_database_id_PubMed' 3 4 'Structure model' '_citation.title' 4 4 'Structure model' '_citation_author.name' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_pdbx_entity_src_syn.details' 10 5 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id' 11 5 'Structure model' '_pdbx_entity_src_syn.organism_common_name' 12 5 'Structure model' '_pdbx_entity_src_syn.organism_scientific' 13 5 'Structure model' '_pdbx_nmr_software.authors' 14 5 'Structure model' '_pdbx_nmr_software.classification' 15 5 'Structure model' '_pdbx_nmr_spectrometer.manufacturer' 16 5 'Structure model' '_pdbx_nmr_spectrometer.model' 17 6 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 50.18 86.30 2 1 VAL A 11 ? ? 58.08 154.70 3 1 TRP A 13 ? ? -159.42 81.03 4 1 PRO A 14 ? ? -80.66 45.22 5 1 ARG A 22 ? ? -87.45 -76.13 6 1 ALA A 23 ? ? 155.77 -84.36 7 1 GLU A 24 ? ? 176.77 112.44 8 1 ASP A 28 ? ? 47.03 71.65 9 1 ALA A 33 ? ? -76.14 -79.78 10 1 SER A 34 ? ? -87.89 -77.52 11 1 ARG A 35 ? ? -100.32 -98.68 12 1 ASP A 36 ? ? -125.66 -62.71 13 1 ALA A 49 ? ? 53.28 -129.50 14 1 ALA A 50 ? ? 53.36 -153.65 15 1 ASN A 52 ? ? 44.17 85.54 16 1 ALA A 54 ? ? 57.99 -167.66 17 2 LYS A 4 ? ? 53.38 104.63 18 2 GLU A 18 ? ? -53.72 -70.47 19 2 ALA A 23 ? ? 52.57 -170.89 20 2 ALA A 27 ? ? -125.90 -156.00 21 2 ALA A 32 ? ? 168.35 135.89 22 2 SER A 34 ? ? -85.44 -89.29 23 2 ARG A 35 ? ? -108.26 -91.89 24 2 SER A 46 ? ? -160.78 78.66 25 2 ALA A 49 ? ? 50.32 -145.86 26 2 ALA A 50 ? ? 61.89 128.07 27 2 ASN A 51 ? ? -131.34 -111.58 28 2 ALA A 53 ? ? -170.65 -122.50 29 2 ALA A 54 ? ? 63.88 148.20 30 2 CYS A 55 ? ? -178.53 128.67 31 2 ALA A 56 ? ? 171.61 172.56 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 17 ? ? 0.310 'SIDE CHAIN' 2 1 ARG A 19 ? ? 0.299 'SIDE CHAIN' 3 1 ARG A 21 ? ? 0.314 'SIDE CHAIN' 4 1 ARG A 22 ? ? 0.317 'SIDE CHAIN' 5 1 ARG A 35 ? ? 0.316 'SIDE CHAIN' 6 2 ARG A 17 ? ? 0.316 'SIDE CHAIN' 7 2 ARG A 19 ? ? 0.315 'SIDE CHAIN' 8 2 ARG A 21 ? ? 0.313 'SIDE CHAIN' 9 2 ARG A 22 ? ? 0.299 'SIDE CHAIN' 10 2 ARG A 35 ? ? 0.318 'SIDE CHAIN' #