data_1QCZ # _entry.id 1QCZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.289 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QCZ RCSB RCSB009088 WWPDB D_1000009088 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QCZ _pdbx_database_status.recvd_initial_deposition_date 1999-05-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site NDB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ealick, S.E.' 1 'Mathews, I.I.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Crystal structure of Escherichia coli PurE, an unusual mutase in the purine biosynthetic pathway.' 'Structure Fold.Des.' 7 1395 1406 1999 FODEFH UK 0969-2126 1263 ? 10574791 '10.1016/S0969-2126(00)80029-5' 1 ;Evidence for the Direct Transfer of the Carboxylate of N5-Carboxyaminoimidazole Ribonucleotide (N5-CAIR) to Generate 4-Carboxy-5-Aminoimidazole Ribonucleotide Catalyzed by Escherichia coli purE, an N5-CAIR Mutase ; Biochemistry 38 3012 ? 1999 BICHAW US 0006-2960 0033 ? ? 10.1021/bi9827159 2 ;Reactions Catalyzed by 5-Aminoimidazole Ribonucleotide Carboxylases from Escherichia coli Carboxylases from Escherichia coli and Gallus gallus: a Case for Divergent Catalytic Mechanisms ; Biochemistry 33 11927 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 3 ;N5-Carboxyaminoimidazole Ribonucleotide: Evidence for a New Intermediate and Two New Enzymatic Activities in the de novo Purine Biosynthetic Pathway of Escherichia coli ; Biochemistry 33 2269 2278 1994 BICHAW US 0006-2960 0033 ? ? ? 4 ;Nucleotide Sequence Analysis of the purEK Operon Encoding 5'-Phosphoribosyl-5-Aminoimidazole Carboxylase of Escherichia coli K-12 ; J.Bacteriol. 171 205 ? 1989 JOBAAY US 0021-9193 0767 ? ? ? 5 ;Identification and Sequence Analysis of Escherichia coli purE and purK Genes Encoding 5'-Phosphoribosyl-5-Amino-4-Imidazole Carboxylase for de novo Purine Biosynthesis ; J.Bacteriol. 171 198 ? 1989 JOBAAY US 0021-9193 0767 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Mathews, I.I.' 1 primary 'Kappock, T.J.' 2 primary 'Stubbe, J.' 3 primary 'Ealick, S.E.' 4 1 'Meyer, E.' 5 1 'Kappock, T.J.' 6 1 'Osuji, C.' 7 1 'Stubbe, J.' 8 2 'Firestine, S.M.' 9 2 'Poon, S.W.' 10 2 'Mueller, E.J.' 11 2 'Stubbe, J.' 12 2 'Davisson, V.J.' 13 3 'Mueller, E.J.' 14 3 'Meyer, E.' 15 3 'Rudolph, J.' 16 3 'Davisson, V.J.' 17 3 'Stubbe, J.' 18 4 'Tiedeman, A.A.' 19 4 'Keyhani, J.' 20 4 'Kamholz, J.' 21 4 '3D Daum, H.A.' 22 4 'Gots, J.S.' 23 4 'Smith, J.M.' 24 5 'Watanabe, W.' 25 5 'Sampei, G.' 26 5 'Aiba, A.' 27 5 'Mizobuchi, K.' 28 # _cell.entry_id 1QCZ _cell.length_a 113.040 _cell.length_b 113.040 _cell.length_c 49.410 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QCZ _symmetry.space_group_name_H-M 'I 4 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 97 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE' 17986.852 1 4.1.1.21 ? ? ? 2 water nat water 18.015 171 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PURE # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MSSRNNPARVAIV(MSE)GSKSDWAT(MSE)QFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGG AAHLPG(MSE)IAAKTLVPVLGVPVQSAALSGVDSLYSIVQ(MSE)PRGIPVGTLAIGKAGAANAALLAAQILATHDKEL HQRLNDWRKAQTDEVLENPDPRGAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAHRTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMI AAKTLVPVLGVPVQSAALSGVDSLYSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVL ENPDPRGAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 ARG n 1 5 ASN n 1 6 ASN n 1 7 PRO n 1 8 ALA n 1 9 ARG n 1 10 VAL n 1 11 ALA n 1 12 ILE n 1 13 VAL n 1 14 MSE n 1 15 GLY n 1 16 SER n 1 17 LYS n 1 18 SER n 1 19 ASP n 1 20 TRP n 1 21 ALA n 1 22 THR n 1 23 MSE n 1 24 GLN n 1 25 PHE n 1 26 ALA n 1 27 ALA n 1 28 GLU n 1 29 ILE n 1 30 PHE n 1 31 GLU n 1 32 ILE n 1 33 LEU n 1 34 ASN n 1 35 VAL n 1 36 PRO n 1 37 HIS n 1 38 HIS n 1 39 VAL n 1 40 GLU n 1 41 VAL n 1 42 VAL n 1 43 SER n 1 44 ALA n 1 45 HIS n 1 46 ARG n 1 47 THR n 1 48 PRO n 1 49 ASP n 1 50 LYS n 1 51 LEU n 1 52 PHE n 1 53 SER n 1 54 PHE n 1 55 ALA n 1 56 GLU n 1 57 SER n 1 58 ALA n 1 59 GLU n 1 60 GLU n 1 61 ASN n 1 62 GLY n 1 63 TYR n 1 64 GLN n 1 65 VAL n 1 66 ILE n 1 67 ILE n 1 68 ALA n 1 69 GLY n 1 70 ALA n 1 71 GLY n 1 72 GLY n 1 73 ALA n 1 74 ALA n 1 75 HIS n 1 76 LEU n 1 77 PRO n 1 78 GLY n 1 79 MSE n 1 80 ILE n 1 81 ALA n 1 82 ALA n 1 83 LYS n 1 84 THR n 1 85 LEU n 1 86 VAL n 1 87 PRO n 1 88 VAL n 1 89 LEU n 1 90 GLY n 1 91 VAL n 1 92 PRO n 1 93 VAL n 1 94 GLN n 1 95 SER n 1 96 ALA n 1 97 ALA n 1 98 LEU n 1 99 SER n 1 100 GLY n 1 101 VAL n 1 102 ASP n 1 103 SER n 1 104 LEU n 1 105 TYR n 1 106 SER n 1 107 ILE n 1 108 VAL n 1 109 GLN n 1 110 MSE n 1 111 PRO n 1 112 ARG n 1 113 GLY n 1 114 ILE n 1 115 PRO n 1 116 VAL n 1 117 GLY n 1 118 THR n 1 119 LEU n 1 120 ALA n 1 121 ILE n 1 122 GLY n 1 123 LYS n 1 124 ALA n 1 125 GLY n 1 126 ALA n 1 127 ALA n 1 128 ASN n 1 129 ALA n 1 130 ALA n 1 131 LEU n 1 132 LEU n 1 133 ALA n 1 134 ALA n 1 135 GLN n 1 136 ILE n 1 137 LEU n 1 138 ALA n 1 139 THR n 1 140 HIS n 1 141 ASP n 1 142 LYS n 1 143 GLU n 1 144 LEU n 1 145 HIS n 1 146 GLN n 1 147 ARG n 1 148 LEU n 1 149 ASN n 1 150 ASP n 1 151 TRP n 1 152 ARG n 1 153 LYS n 1 154 ALA n 1 155 GLN n 1 156 THR n 1 157 ASP n 1 158 GLU n 1 159 VAL n 1 160 LEU n 1 161 GLU n 1 162 ASN n 1 163 PRO n 1 164 ASP n 1 165 PRO n 1 166 ARG n 1 167 GLY n 1 168 ALA n 1 169 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene PURE _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNC2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PUR6_ECOLI _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P09028 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QCZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09028 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1QCZ MSE A 14 ? UNP P09028 MET 14 'MODIFIED RESIDUE' 14 1 1 1QCZ MSE A 23 ? UNP P09028 MET 23 'MODIFIED RESIDUE' 23 2 1 1QCZ MSE A 79 ? UNP P09028 MET 79 'MODIFIED RESIDUE' 79 3 1 1QCZ MSE A 110 ? UNP P09028 MET 110 'MODIFIED RESIDUE' 110 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1QCZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_percent_sol 55 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 291.0 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 8.00 _exptl_crystal_grow.pdbx_details 'PEG400, TRIS.HCL, MAGNESIUM CHLORIDE, pH 8.00, VAPOR DIFFUSION, HANGING DROP, temperature 18K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 180 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 1998-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'CHESS BEAMLINE F1' _diffrn_source.pdbx_synchrotron_site CHESS _diffrn_source.pdbx_synchrotron_beamline F1 _diffrn_source.pdbx_wavelength 0.918 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1QCZ _reflns.observed_criterion_sigma_I 1.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.0 _reflns.d_resolution_high 1.50 _reflns.number_obs 25072 _reflns.number_all 193682 _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs 0.0770000 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 6.8 _reflns.B_iso_Wilson_estimate 14.6 _reflns.pdbx_redundancy 7.7 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.58 _reflns_shell.percent_possible_all 86.7 _reflns_shell.Rmerge_I_obs 0.1720000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 3.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1QCZ _refine.ls_number_reflns_obs 24987 _refine.ls_number_reflns_all 25065 _refine.pdbx_ls_sigma_I 1.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 20.0 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs ? _refine.ls_R_factor_all 0.1890000 _refine.ls_R_factor_R_work 0.1860000 _refine.ls_R_factor_R_free 0.2130000 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 1252 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 14.2 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1QCZ _refine_analyze.Luzzati_coordinate_error_obs 0.1645 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free 0.1882 _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1196 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 1367 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d 0.007 ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg 1.23 ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d 22.9 ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d 1.21 ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 1.36 1.50 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 1.95 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 2.15 2.00 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 3.18 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 8 _refine_ls_shell.d_res_high 1.5 _refine_ls_shell.d_res_low 1.57 _refine_ls_shell.number_reflns_R_work 2499 _refine_ls_shell.R_factor_R_work 0.2560000 _refine_ls_shell.percent_reflns_obs 83 _refine_ls_shell.R_factor_R_free 0.2620000 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5 _refine_ls_shell.number_reflns_R_free 133 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_all ? # _struct.entry_id 1QCZ _struct.title ;CRYSTAL STRUCTURE OF E. COLI PURE, AN UNUSUAL MUTASE THAT CATALYZES THE CONVERSION OF N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE (N5-CAIR) TO 4-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE (CAIR) IN THE PURINE BIOSYNTHETIC PATHWAY ; _struct.pdbx_descriptor 'N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE (E.C.4.1.1.21)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QCZ _struct_keywords.pdbx_keywords LYASE _struct_keywords.text 'THREE-LAYER (ALPHA-BETA-ALPHA) SANDWICH, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a octamer which is generated from chain A by the 4-fold and 2-fold symmetry' _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? SER A 18 ? SER A 16 SER A 18 5 ? 3 HELX_P HELX_P2 2 ASP A 19 ? ASN A 34 ? ASP A 19 ASN A 34 1 ? 16 HELX_P HELX_P3 3 THR A 47 ? ALA A 58 ? THR A 47 ALA A 58 1 ? 12 HELX_P HELX_P4 4 HIS A 75 ? LYS A 83 ? HIS A 75 LYS A 83 1 ? 9 HELX_P HELX_P5 5 GLY A 100 ? GLN A 109 ? GLY A 100 GLN A 109 1 ? 10 HELX_P HELX_P6 6 GLY A 122 ? THR A 139 ? GLY A 122 THR A 139 1 ? 18 HELX_P HELX_P7 7 ASP A 141 ? GLU A 161 ? ASP A 141 GLU A 161 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A VAL 13 C ? ? ? 1_555 A MSE 14 N ? ? A VAL 13 A MSE 14 1_555 ? ? ? ? ? ? ? 1.326 ? covale2 covale ? ? A MSE 14 C ? ? ? 1_555 A GLY 15 N ? ? A MSE 14 A GLY 15 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A THR 22 C ? ? ? 1_555 A MSE 23 N ? ? A THR 22 A MSE 23 1_555 ? ? ? ? ? ? ? 1.332 ? covale4 covale ? ? A MSE 23 C ? ? ? 1_555 A GLN 24 N ? ? A MSE 23 A GLN 24 1_555 ? ? ? ? ? ? ? 1.333 ? covale5 covale ? ? A GLY 78 C ? ? ? 1_555 A MSE 79 N ? ? A GLY 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.328 ? covale6 covale ? ? A MSE 79 C ? ? ? 1_555 A ILE 80 N ? ? A MSE 79 A ILE 80 1_555 ? ? ? ? ? ? ? 1.337 ? covale7 covale ? ? A GLN 109 C ? ? ? 1_555 A MSE 110 N ? ? A GLN 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale ? ? A MSE 110 C ? ? ? 1_555 A PRO 111 N ? ? A MSE 110 A PRO 111 1_555 ? ? ? ? ? ? ? 1.347 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 37 ? VAL A 41 ? HIS A 37 VAL A 41 A 2 VAL A 10 ? MSE A 14 ? VAL A 10 MSE A 14 A 3 VAL A 65 ? ALA A 70 ? VAL A 65 ALA A 70 A 4 VAL A 88 ? PRO A 92 ? VAL A 88 PRO A 92 A 5 GLY A 117 ? THR A 118 ? GLY A 117 THR A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 38 ? N HIS A 38 O VAL A 10 ? O VAL A 10 A 2 3 N ALA A 11 ? N ALA A 11 O VAL A 65 ? O VAL A 65 A 3 4 O ILE A 66 ? O ILE A 66 N LEU A 89 ? N LEU A 89 A 4 5 O VAL A 88 ? O VAL A 88 N GLY A 117 ? N GLY A 117 # _database_PDB_matrix.entry_id 1QCZ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QCZ _atom_sites.fract_transf_matrix[1][1] 0.008846 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008846 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020239 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ARG 4 4 ? ? ? A . n A 1 5 ASN 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 MSE 14 14 14 MSE MSE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 MSE 23 23 23 MSE MSE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 HIS 45 45 45 HIS HIS A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 MSE 79 79 79 MSE MSE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 ALA 126 126 126 ALA ALA A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 GLN 135 135 135 GLN GLN A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 THR 139 139 139 THR THR A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 HIS 145 145 145 HIS HIS A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 ASP 150 150 150 ASP ASP A . n A 1 151 TRP 151 151 151 TRP TRP A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ALA 169 169 169 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 201 HOH HOH A . B 2 HOH 2 202 202 HOH HOH A . B 2 HOH 3 203 203 HOH HOH A . B 2 HOH 4 204 204 HOH HOH A . B 2 HOH 5 205 205 HOH HOH A . B 2 HOH 6 206 206 HOH HOH A . B 2 HOH 7 207 207 HOH HOH A . B 2 HOH 8 208 208 HOH HOH A . B 2 HOH 9 209 209 HOH HOH A . B 2 HOH 10 210 210 HOH HOH A . B 2 HOH 11 211 211 HOH HOH A . B 2 HOH 12 212 212 HOH HOH A . B 2 HOH 13 213 213 HOH HOH A . B 2 HOH 14 214 214 HOH HOH A . B 2 HOH 15 215 215 HOH HOH A . B 2 HOH 16 216 216 HOH HOH A . B 2 HOH 17 217 217 HOH HOH A . B 2 HOH 18 218 218 HOH HOH A . B 2 HOH 19 219 219 HOH HOH A . B 2 HOH 20 220 220 HOH HOH A . B 2 HOH 21 221 221 HOH HOH A . B 2 HOH 22 222 222 HOH HOH A . B 2 HOH 23 223 223 HOH HOH A . B 2 HOH 24 224 224 HOH HOH A . B 2 HOH 25 225 225 HOH HOH A . B 2 HOH 26 226 226 HOH HOH A . B 2 HOH 27 227 227 HOH HOH A . B 2 HOH 28 228 228 HOH HOH A . B 2 HOH 29 229 229 HOH HOH A . B 2 HOH 30 230 230 HOH HOH A . B 2 HOH 31 231 231 HOH HOH A . B 2 HOH 32 232 232 HOH HOH A . B 2 HOH 33 233 233 HOH HOH A . B 2 HOH 34 234 234 HOH HOH A . B 2 HOH 35 235 235 HOH HOH A . B 2 HOH 36 236 236 HOH HOH A . B 2 HOH 37 237 237 HOH HOH A . B 2 HOH 38 238 238 HOH HOH A . B 2 HOH 39 239 239 HOH HOH A . B 2 HOH 40 240 240 HOH HOH A . B 2 HOH 41 241 241 HOH HOH A . B 2 HOH 42 242 242 HOH HOH A . B 2 HOH 43 243 243 HOH HOH A . B 2 HOH 44 244 244 HOH HOH A . B 2 HOH 45 245 245 HOH HOH A . B 2 HOH 46 246 246 HOH HOH A . B 2 HOH 47 247 247 HOH HOH A . B 2 HOH 48 248 248 HOH HOH A . B 2 HOH 49 249 249 HOH HOH A . B 2 HOH 50 250 250 HOH HOH A . B 2 HOH 51 251 251 HOH HOH A . B 2 HOH 52 252 252 HOH HOH A . B 2 HOH 53 253 253 HOH HOH A . B 2 HOH 54 254 254 HOH HOH A . B 2 HOH 55 255 255 HOH HOH A . B 2 HOH 56 256 256 HOH HOH A . B 2 HOH 57 257 257 HOH HOH A . B 2 HOH 58 258 258 HOH HOH A . B 2 HOH 59 259 259 HOH HOH A . B 2 HOH 60 260 260 HOH HOH A . B 2 HOH 61 261 261 HOH HOH A . B 2 HOH 62 262 262 HOH HOH A . B 2 HOH 63 263 263 HOH HOH A . B 2 HOH 64 264 264 HOH HOH A . B 2 HOH 65 265 265 HOH HOH A . B 2 HOH 66 266 266 HOH HOH A . B 2 HOH 67 267 267 HOH HOH A . B 2 HOH 68 268 268 HOH HOH A . B 2 HOH 69 269 269 HOH HOH A . B 2 HOH 70 270 270 HOH HOH A . B 2 HOH 71 271 271 HOH HOH A . B 2 HOH 72 272 272 HOH HOH A . B 2 HOH 73 273 273 HOH HOH A . B 2 HOH 74 274 274 HOH HOH A . B 2 HOH 75 275 275 HOH HOH A . B 2 HOH 76 276 276 HOH HOH A . B 2 HOH 77 277 277 HOH HOH A . B 2 HOH 78 278 278 HOH HOH A . B 2 HOH 79 279 279 HOH HOH A . B 2 HOH 80 280 280 HOH HOH A . B 2 HOH 81 281 281 HOH HOH A . B 2 HOH 82 282 282 HOH HOH A . B 2 HOH 83 283 283 HOH HOH A . B 2 HOH 84 284 284 HOH HOH A . B 2 HOH 85 285 285 HOH HOH A . B 2 HOH 86 286 286 HOH HOH A . B 2 HOH 87 287 287 HOH HOH A . B 2 HOH 88 288 288 HOH HOH A . B 2 HOH 89 289 289 HOH HOH A . B 2 HOH 90 290 290 HOH HOH A . B 2 HOH 91 291 291 HOH HOH A . B 2 HOH 92 292 292 HOH HOH A . B 2 HOH 93 293 293 HOH HOH A . B 2 HOH 94 294 294 HOH HOH A . B 2 HOH 95 295 295 HOH HOH A . B 2 HOH 96 296 296 HOH HOH A . B 2 HOH 97 297 297 HOH HOH A . B 2 HOH 98 298 298 HOH HOH A . B 2 HOH 99 299 299 HOH HOH A . B 2 HOH 100 300 300 HOH HOH A . B 2 HOH 101 301 301 HOH HOH A . B 2 HOH 102 302 302 HOH HOH A . B 2 HOH 103 303 303 HOH HOH A . B 2 HOH 104 304 304 HOH HOH A . B 2 HOH 105 305 305 HOH HOH A . B 2 HOH 106 306 306 HOH HOH A . B 2 HOH 107 307 307 HOH HOH A . B 2 HOH 108 308 308 HOH HOH A . B 2 HOH 109 309 309 HOH HOH A . B 2 HOH 110 310 310 HOH HOH A . B 2 HOH 111 311 311 HOH HOH A . B 2 HOH 112 312 312 HOH HOH A . B 2 HOH 113 313 313 HOH HOH A . B 2 HOH 114 314 314 HOH HOH A . B 2 HOH 115 315 315 HOH HOH A . B 2 HOH 116 316 316 HOH HOH A . B 2 HOH 117 317 317 HOH HOH A . B 2 HOH 118 318 318 HOH HOH A . B 2 HOH 119 319 319 HOH HOH A . B 2 HOH 120 320 320 HOH HOH A . B 2 HOH 121 321 321 HOH HOH A . B 2 HOH 122 322 322 HOH HOH A . B 2 HOH 123 323 323 HOH HOH A . B 2 HOH 124 324 324 HOH HOH A . B 2 HOH 125 325 325 HOH HOH A . B 2 HOH 126 326 326 HOH HOH A . B 2 HOH 127 327 327 HOH HOH A . B 2 HOH 128 328 328 HOH HOH A . B 2 HOH 129 329 329 HOH HOH A . B 2 HOH 130 330 330 HOH HOH A . B 2 HOH 131 331 331 HOH HOH A . B 2 HOH 132 332 332 HOH HOH A . B 2 HOH 133 333 333 HOH HOH A . B 2 HOH 134 334 334 HOH HOH A . B 2 HOH 135 335 335 HOH HOH A . B 2 HOH 136 336 336 HOH HOH A . B 2 HOH 137 337 337 HOH HOH A . B 2 HOH 138 338 338 HOH HOH A . B 2 HOH 139 339 339 HOH HOH A . B 2 HOH 140 340 340 HOH HOH A . B 2 HOH 141 341 341 HOH HOH A . B 2 HOH 142 342 342 HOH HOH A . B 2 HOH 143 343 343 HOH HOH A . B 2 HOH 144 344 344 HOH HOH A . B 2 HOH 145 345 345 HOH HOH A . B 2 HOH 146 346 346 HOH HOH A . B 2 HOH 147 347 347 HOH HOH A . B 2 HOH 148 348 348 HOH HOH A . B 2 HOH 149 349 349 HOH HOH A . B 2 HOH 150 350 350 HOH HOH A . B 2 HOH 151 351 351 HOH HOH A . B 2 HOH 152 352 352 HOH HOH A . B 2 HOH 153 353 353 HOH HOH A . B 2 HOH 154 354 354 HOH HOH A . B 2 HOH 155 355 355 HOH HOH A . B 2 HOH 156 356 356 HOH HOH A . B 2 HOH 157 357 357 HOH HOH A . B 2 HOH 158 358 358 HOH HOH A . B 2 HOH 159 359 359 HOH HOH A . B 2 HOH 160 360 360 HOH HOH A . B 2 HOH 161 361 361 HOH HOH A . B 2 HOH 162 362 362 HOH HOH A . B 2 HOH 163 363 363 HOH HOH A . B 2 HOH 164 364 364 HOH HOH A . B 2 HOH 165 365 365 HOH HOH A . B 2 HOH 166 366 366 HOH HOH A . B 2 HOH 167 367 367 HOH HOH A . B 2 HOH 168 368 368 HOH HOH A . B 2 HOH 169 369 369 HOH HOH A . B 2 HOH 170 370 370 HOH HOH A . B 2 HOH 171 371 371 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 14 A MSE 14 ? MET SELENOMETHIONINE 2 A MSE 23 A MSE 23 ? MET SELENOMETHIONINE 3 A MSE 79 A MSE 79 ? MET SELENOMETHIONINE 4 A MSE 110 A MSE 110 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details octameric _pdbx_struct_assembly.oligomeric_count 8 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 32150 ? 1 MORE -211 ? 1 'SSA (A^2)' 41210 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -y,x,z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 y,-x,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_554 -x,y,-z-1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.4100000000 6 'crystal symmetry operation' 6_554 x,-y,-z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.4100000000 7 'crystal symmetry operation' 7_554 y,x,-z-1 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.4100000000 8 'crystal symmetry operation' 8_554 -y,-x,-z-1 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -49.4100000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 366 ? B HOH . 2 1 A HOH 367 ? B HOH . 3 1 A HOH 368 ? B HOH . 4 1 A HOH 369 ? B HOH . 5 1 A HOH 370 ? B HOH . 6 1 A HOH 371 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-11-10 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-04 5 'Structure model' 1 4 2018-01-31 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Experimental preparation' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' software 2 5 'Structure model' exptl_crystal_grow # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 5 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_exptl_crystal_grow.temp' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHAKE 'model building' . ? 1 SnB phasing . ? 2 X-PLOR refinement 3.843 ? 3 MOSFLM 'data reduction' . ? 4 CCP4 'data scaling' '(SCALA)' ? 5 # _pdbx_entry_details.entry_id 1QCZ _pdbx_entry_details.compound_details ;THE SUBSTRATE SPECIFICITY OF E. COLI PURE FOR N5-CAIR DIFFERS FROM VERTEBRATE PURE (AIR CARBOXYLASE, EC 4.1.1.21), WHICH CONVERTS CARBON DIOXIDE AND 5-AMINOIMIDAZOLE RIBONUCLEOTIDE (AIR) INTO 4-CARBOXY-5-AMINOIMIDAZOLE RIBONUCLEOTIDE (CAIR). DETAILS ARE GIVEN IN REFERENCES 1, 2, AND 3. PLANTS, YEASTS, AND PROKARYOTES CONTAIN A SEPAATE ENZYME, PURK (PDB CODE 1B6R), REQUIRED FOR THE PRODUCTION OF N5-CAIR. E. COLI PURE AND PURK ARE NOT SUBUNITS OF A SINGLE AIR CARBOXYLASE ENZYME. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 109 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -79.14 _pdbx_validate_torsion.psi 27.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PRO 7 ? CB ? A PRO 7 CB 2 1 Y 1 A PRO 7 ? CG ? A PRO 7 CG 3 1 Y 1 A PRO 7 ? CD ? A PRO 7 CD 4 1 Y 1 A ALA 169 ? CA ? A ALA 169 CA 5 1 Y 1 A ALA 169 ? C ? A ALA 169 C 6 1 Y 1 A ALA 169 ? O ? A ALA 169 O 7 1 Y 1 A ALA 169 ? CB ? A ALA 169 CB # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ARG 4 ? A ARG 4 5 1 Y 1 A ASN 5 ? A ASN 5 6 1 Y 1 A ASN 6 ? A ASN 6 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #