data_1QGM # _entry.id 1QGM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1QGM pdb_00001qgm 10.2210/pdb1qgm/pdb RCSB RCSB000979 ? ? WWPDB D_1000000979 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-12-22 2 'Structure model' 1 1 2008-04-26 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2023-12-27 6 'Structure model' 1 5 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 5 'Structure model' 'Data collection' 6 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_assembly 3 4 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 6 'Structure model' pdbx_entry_details 8 6 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QGM _pdbx_database_status.recvd_initial_deposition_date 1999-05-01 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Vranken, W.F.' 1 'Xu, P.' 2 'Ni, F.' 3 # _citation.id primary _citation.title ;A 30-residue fragment of the carp granulin-1 protein folds into a stack of two beta-hairpins similar to that found in the native protein. ; _citation.journal_abbrev J.Pept.Res. _citation.journal_volume 53 _citation.page_first 590 _citation.page_last 597 _citation.year 1999 _citation.journal_id_ASTM JPERFA _citation.country DK _citation.journal_id_ISSN 1397-002X _citation.journal_id_CSD 2150 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10424355 _citation.pdbx_database_id_DOI 10.1034/j.1399-3011.1999.00048.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Vranken, W.F.' 1 ? primary 'Chen, Z.G.' 2 ? primary 'Xu, P.' 3 ? primary 'James, S.' 4 ? primary 'Bennett, H.P.' 5 ? primary 'Ni, F.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'PROTEIN (AMINO-TERMINAL CARP GRANULIN-1)' _entity.formula_weight 3195.601 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'C17S, C27S' _entity.pdbx_fragment 'AMINO-TERMINAL FRAGMENT' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VIHCDAATICPDGTTCSLSPYGVWYCSPFS _entity_poly.pdbx_seq_one_letter_code_can VIHCDAATICPDGTTCSLSPYGVWYCSPFS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 ILE n 1 3 HIS n 1 4 CYS n 1 5 ASP n 1 6 ALA n 1 7 ALA n 1 8 THR n 1 9 ILE n 1 10 CYS n 1 11 PRO n 1 12 ASP n 1 13 GLY n 1 14 THR n 1 15 THR n 1 16 CYS n 1 17 SER n 1 18 LEU n 1 19 SER n 1 20 PRO n 1 21 TYR n 1 22 GLY n 1 23 VAL n 1 24 TRP n 1 25 TYR n 1 26 CYS n 1 27 SER n 1 28 PRO n 1 29 PHE n 1 30 SER n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'THE PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THE PEPTIDE IS NATURALLY FOUND IN CYPRINUS CARPIO (CARP).' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n # _cell.entry_id 1QGM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QGM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 1QGM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 1QGM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1QGM _struct.title 'THE SOLUTION STRUCTURE OF A 30 RESIDUE AMINO-TERMINAL DOMAIN OF THE CARP GRANULIN-1 PROTEIN.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QGM _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'BETA-HAIRPIN STACK, CONFORMATIONAL STABILITY, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRN1_CYPCA _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P81013 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QGM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P81013 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 30 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 1QGM SER A 17 ? UNP P81013 CYS 17 'engineered mutation' 17 1 1 1QGM SER A 27 ? UNP P81013 CYS 27 'engineered mutation' 27 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 4 A CYS 16 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 10 A CYS 26 1_555 ? ? ? ? ? ? ? 2.020 ? ? hydrog1 hydrog ? ? A THR 15 N ? ? ? 1_555 A SER 27 O ? ? A THR 15 A SER 27 1_555 ? ? ? ? ? ? ? ? ? ? hydrog2 hydrog ? ? A SER 19 N ? ? ? 1_555 A VAL 23 O ? ? A SER 19 A VAL 23 1_555 ? ? ? ? ? ? ? ? ? ? hydrog3 hydrog ? ? A SER 27 N ? ? ? 1_555 A THR 15 O ? ? A SER 27 A THR 15 1_555 ? ? ? ? ? ? ? ? ? ? hydrog4 hydrog ? ? A SER 17 N ? ? ? 1_555 A TYR 25 O ? ? A SER 17 A TYR 25 1_555 ? ? ? ? ? ? ? ? ? ? hydrog5 hydrog ? ? A GLY 22 N ? ? ? 1_555 A SER 19 O ? ? A GLY 22 A SER 19 1_555 ? ? ? ? ? ? ? ? ? ? hydrog6 hydrog ? ? A TYR 25 N ? ? ? 1_555 A SER 17 O ? ? A TYR 25 A SER 17 1_555 ? ? ? ? ? ? ? ? ? ? hydrog7 hydrog ? ? A VAL 23 N ? ? ? 1_555 A SER 19 OG ? ? A VAL 23 A SER 19 1_555 ? ? ? ? ? ? ? ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? hydrog ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 4 ? CYS A 16 ? CYS A 4 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 26 ? CYS A 10 ? 1_555 CYS A 26 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 15 ? LEU A 18 ? THR A 15 LEU A 18 A 2 TRP A 24 ? SER A 27 ? TRP A 24 SER A 27 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 15 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 15 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 27 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 27 # _pdbx_entry_details.entry_id 1QGM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 H A ILE 2 ? ? O A CYS 10 ? ? 1.53 2 4 OD2 A ASP 5 ? ? H A ALA 7 ? ? 1.54 3 6 OG A SER 17 ? ? HH A TYR 25 ? ? 1.60 4 11 O A HIS 3 ? ? H A ASP 5 ? ? 1.58 5 13 H A ILE 2 ? ? O A CYS 10 ? ? 1.57 6 14 H A ILE 2 ? ? O A CYS 10 ? ? 1.59 7 15 O A ILE 2 ? ? H A CYS 10 ? ? 1.53 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 4 ? ? -161.05 -36.74 2 1 ASP A 5 ? ? -93.91 -78.93 3 1 ALA A 6 ? ? 171.72 -31.44 4 1 PRO A 11 ? ? -72.46 -161.10 5 2 ASP A 5 ? ? -90.86 -70.01 6 2 ALA A 6 ? ? 175.17 -46.55 7 2 PRO A 11 ? ? -72.96 -166.29 8 3 CYS A 4 ? ? -149.17 22.90 9 3 ALA A 7 ? ? -136.33 -46.33 10 3 PRO A 11 ? ? -74.51 -166.60 11 4 ILE A 2 ? ? -45.38 155.69 12 4 HIS A 3 ? ? -130.64 -60.59 13 4 CYS A 4 ? ? 66.75 -67.97 14 4 ASP A 5 ? ? -80.88 -138.83 15 4 ALA A 7 ? ? -137.13 -65.54 16 4 PRO A 11 ? ? -74.91 -161.18 17 5 ASP A 5 ? ? -104.63 -90.27 18 5 ALA A 6 ? ? -146.66 10.28 19 5 ALA A 7 ? ? -140.11 -76.27 20 5 SER A 19 ? ? -46.18 157.81 21 6 ASP A 5 ? ? -150.29 -90.23 22 6 ALA A 6 ? ? -176.09 -32.39 23 6 ALA A 7 ? ? -105.38 -75.50 24 6 PRO A 11 ? ? -74.70 -90.34 25 7 ASP A 5 ? ? -85.14 -86.57 26 7 ALA A 6 ? ? 170.31 -27.66 27 7 ALA A 7 ? ? -105.01 -81.51 28 7 THR A 8 ? ? -41.18 155.40 29 8 ASP A 5 ? ? -125.18 -59.75 30 8 ALA A 6 ? ? 170.60 -25.37 31 8 SER A 17 ? ? -170.31 137.26 32 9 ASP A 5 ? ? -167.65 -128.95 33 9 ALA A 6 ? ? -141.10 11.54 34 9 ALA A 7 ? ? -139.93 -85.10 35 10 ASP A 5 ? ? 54.75 -88.77 36 10 ALA A 6 ? ? -171.90 -40.20 37 10 THR A 8 ? ? -43.77 151.81 38 11 CYS A 4 ? ? 66.07 -61.28 39 11 ASP A 5 ? ? -126.32 -56.44 40 11 ALA A 6 ? ? 176.34 -32.48 41 11 ALA A 7 ? ? -100.07 -77.97 42 12 HIS A 3 ? ? -136.70 -48.03 43 12 CYS A 4 ? ? 59.00 -77.11 44 12 ASP A 5 ? ? -78.74 -135.67 45 12 ALA A 7 ? ? -139.91 -84.72 46 12 THR A 8 ? ? -40.89 100.26 47 12 PRO A 11 ? ? -80.00 -159.59 48 13 ASP A 5 ? ? -130.96 -101.12 49 13 ALA A 6 ? ? -162.80 -43.15 50 13 PRO A 11 ? ? -76.28 -166.08 51 14 ASP A 5 ? ? -116.34 -89.64 52 14 ALA A 6 ? ? -171.89 -32.84 53 14 ALA A 7 ? ? -99.31 -83.63 54 14 THR A 8 ? ? -52.17 106.55 55 15 ILE A 2 ? ? -44.10 152.87 56 15 HIS A 3 ? ? -120.38 -64.69 57 15 CYS A 4 ? ? 59.65 -72.29 58 15 ASP A 5 ? ? -54.75 -163.67 59 15 ALA A 7 ? ? -135.72 -79.69 60 15 ASP A 12 ? ? 48.66 179.22 61 15 THR A 14 ? ? 44.39 -179.24 # _pdbx_nmr_ensemble.entry_id 1QGM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST VIOLATED RESTRAINT ENERGY' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% H2O/10% D2O, OR 100% D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 TOCSY 1 2 1 COSY 1 3 1 NOESY 1 # _pdbx_nmr_refine.entry_id 1QGM _pdbx_nmr_refine.method 'DISTANCE GEOMETRY AND SIMULATED ANNEALING' _pdbx_nmr_refine.details 'USING THE STANDARD SOFT REFINEMENT PROTOCOL OF X-PLOR.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.1 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 CYS N N N N 30 CYS CA C N R 31 CYS C C N N 32 CYS O O N N 33 CYS CB C N N 34 CYS SG S N N 35 CYS OXT O N N 36 CYS H H N N 37 CYS H2 H N N 38 CYS HA H N N 39 CYS HB2 H N N 40 CYS HB3 H N N 41 CYS HG H N N 42 CYS HXT H N N 43 GLY N N N N 44 GLY CA C N N 45 GLY C C N N 46 GLY O O N N 47 GLY OXT O N N 48 GLY H H N N 49 GLY H2 H N N 50 GLY HA2 H N N 51 GLY HA3 H N N 52 GLY HXT H N N 53 HIS N N N N 54 HIS CA C N S 55 HIS C C N N 56 HIS O O N N 57 HIS CB C N N 58 HIS CG C Y N 59 HIS ND1 N Y N 60 HIS CD2 C Y N 61 HIS CE1 C Y N 62 HIS NE2 N Y N 63 HIS OXT O N N 64 HIS H H N N 65 HIS H2 H N N 66 HIS HA H N N 67 HIS HB2 H N N 68 HIS HB3 H N N 69 HIS HD1 H N N 70 HIS HD2 H N N 71 HIS HE1 H N N 72 HIS HE2 H N N 73 HIS HXT H N N 74 ILE N N N N 75 ILE CA C N S 76 ILE C C N N 77 ILE O O N N 78 ILE CB C N S 79 ILE CG1 C N N 80 ILE CG2 C N N 81 ILE CD1 C N N 82 ILE OXT O N N 83 ILE H H N N 84 ILE H2 H N N 85 ILE HA H N N 86 ILE HB H N N 87 ILE HG12 H N N 88 ILE HG13 H N N 89 ILE HG21 H N N 90 ILE HG22 H N N 91 ILE HG23 H N N 92 ILE HD11 H N N 93 ILE HD12 H N N 94 ILE HD13 H N N 95 ILE HXT H N N 96 LEU N N N N 97 LEU CA C N S 98 LEU C C N N 99 LEU O O N N 100 LEU CB C N N 101 LEU CG C N N 102 LEU CD1 C N N 103 LEU CD2 C N N 104 LEU OXT O N N 105 LEU H H N N 106 LEU H2 H N N 107 LEU HA H N N 108 LEU HB2 H N N 109 LEU HB3 H N N 110 LEU HG H N N 111 LEU HD11 H N N 112 LEU HD12 H N N 113 LEU HD13 H N N 114 LEU HD21 H N N 115 LEU HD22 H N N 116 LEU HD23 H N N 117 LEU HXT H N N 118 PHE N N N N 119 PHE CA C N S 120 PHE C C N N 121 PHE O O N N 122 PHE CB C N N 123 PHE CG C Y N 124 PHE CD1 C Y N 125 PHE CD2 C Y N 126 PHE CE1 C Y N 127 PHE CE2 C Y N 128 PHE CZ C Y N 129 PHE OXT O N N 130 PHE H H N N 131 PHE H2 H N N 132 PHE HA H N N 133 PHE HB2 H N N 134 PHE HB3 H N N 135 PHE HD1 H N N 136 PHE HD2 H N N 137 PHE HE1 H N N 138 PHE HE2 H N N 139 PHE HZ H N N 140 PHE HXT H N N 141 PRO N N N N 142 PRO CA C N S 143 PRO C C N N 144 PRO O O N N 145 PRO CB C N N 146 PRO CG C N N 147 PRO CD C N N 148 PRO OXT O N N 149 PRO H H N N 150 PRO HA H N N 151 PRO HB2 H N N 152 PRO HB3 H N N 153 PRO HG2 H N N 154 PRO HG3 H N N 155 PRO HD2 H N N 156 PRO HD3 H N N 157 PRO HXT H N N 158 SER N N N N 159 SER CA C N S 160 SER C C N N 161 SER O O N N 162 SER CB C N N 163 SER OG O N N 164 SER OXT O N N 165 SER H H N N 166 SER H2 H N N 167 SER HA H N N 168 SER HB2 H N N 169 SER HB3 H N N 170 SER HG H N N 171 SER HXT H N N 172 THR N N N N 173 THR CA C N S 174 THR C C N N 175 THR O O N N 176 THR CB C N R 177 THR OG1 O N N 178 THR CG2 C N N 179 THR OXT O N N 180 THR H H N N 181 THR H2 H N N 182 THR HA H N N 183 THR HB H N N 184 THR HG1 H N N 185 THR HG21 H N N 186 THR HG22 H N N 187 THR HG23 H N N 188 THR HXT H N N 189 TRP N N N N 190 TRP CA C N S 191 TRP C C N N 192 TRP O O N N 193 TRP CB C N N 194 TRP CG C Y N 195 TRP CD1 C Y N 196 TRP CD2 C Y N 197 TRP NE1 N Y N 198 TRP CE2 C Y N 199 TRP CE3 C Y N 200 TRP CZ2 C Y N 201 TRP CZ3 C Y N 202 TRP CH2 C Y N 203 TRP OXT O N N 204 TRP H H N N 205 TRP H2 H N N 206 TRP HA H N N 207 TRP HB2 H N N 208 TRP HB3 H N N 209 TRP HD1 H N N 210 TRP HE1 H N N 211 TRP HE3 H N N 212 TRP HZ2 H N N 213 TRP HZ3 H N N 214 TRP HH2 H N N 215 TRP HXT H N N 216 TYR N N N N 217 TYR CA C N S 218 TYR C C N N 219 TYR O O N N 220 TYR CB C N N 221 TYR CG C Y N 222 TYR CD1 C Y N 223 TYR CD2 C Y N 224 TYR CE1 C Y N 225 TYR CE2 C Y N 226 TYR CZ C Y N 227 TYR OH O N N 228 TYR OXT O N N 229 TYR H H N N 230 TYR H2 H N N 231 TYR HA H N N 232 TYR HB2 H N N 233 TYR HB3 H N N 234 TYR HD1 H N N 235 TYR HD2 H N N 236 TYR HE1 H N N 237 TYR HE2 H N N 238 TYR HH H N N 239 TYR HXT H N N 240 VAL N N N N 241 VAL CA C N S 242 VAL C C N N 243 VAL O O N N 244 VAL CB C N N 245 VAL CG1 C N N 246 VAL CG2 C N N 247 VAL OXT O N N 248 VAL H H N N 249 VAL H2 H N N 250 VAL HA H N N 251 VAL HB H N N 252 VAL HG11 H N N 253 VAL HG12 H N N 254 VAL HG13 H N N 255 VAL HG21 H N N 256 VAL HG22 H N N 257 VAL HG23 H N N 258 VAL HXT H N N 259 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 CYS N CA sing N N 28 CYS N H sing N N 29 CYS N H2 sing N N 30 CYS CA C sing N N 31 CYS CA CB sing N N 32 CYS CA HA sing N N 33 CYS C O doub N N 34 CYS C OXT sing N N 35 CYS CB SG sing N N 36 CYS CB HB2 sing N N 37 CYS CB HB3 sing N N 38 CYS SG HG sing N N 39 CYS OXT HXT sing N N 40 GLY N CA sing N N 41 GLY N H sing N N 42 GLY N H2 sing N N 43 GLY CA C sing N N 44 GLY CA HA2 sing N N 45 GLY CA HA3 sing N N 46 GLY C O doub N N 47 GLY C OXT sing N N 48 GLY OXT HXT sing N N 49 HIS N CA sing N N 50 HIS N H sing N N 51 HIS N H2 sing N N 52 HIS CA C sing N N 53 HIS CA CB sing N N 54 HIS CA HA sing N N 55 HIS C O doub N N 56 HIS C OXT sing N N 57 HIS CB CG sing N N 58 HIS CB HB2 sing N N 59 HIS CB HB3 sing N N 60 HIS CG ND1 sing Y N 61 HIS CG CD2 doub Y N 62 HIS ND1 CE1 doub Y N 63 HIS ND1 HD1 sing N N 64 HIS CD2 NE2 sing Y N 65 HIS CD2 HD2 sing N N 66 HIS CE1 NE2 sing Y N 67 HIS CE1 HE1 sing N N 68 HIS NE2 HE2 sing N N 69 HIS OXT HXT sing N N 70 ILE N CA sing N N 71 ILE N H sing N N 72 ILE N H2 sing N N 73 ILE CA C sing N N 74 ILE CA CB sing N N 75 ILE CA HA sing N N 76 ILE C O doub N N 77 ILE C OXT sing N N 78 ILE CB CG1 sing N N 79 ILE CB CG2 sing N N 80 ILE CB HB sing N N 81 ILE CG1 CD1 sing N N 82 ILE CG1 HG12 sing N N 83 ILE CG1 HG13 sing N N 84 ILE CG2 HG21 sing N N 85 ILE CG2 HG22 sing N N 86 ILE CG2 HG23 sing N N 87 ILE CD1 HD11 sing N N 88 ILE CD1 HD12 sing N N 89 ILE CD1 HD13 sing N N 90 ILE OXT HXT sing N N 91 LEU N CA sing N N 92 LEU N H sing N N 93 LEU N H2 sing N N 94 LEU CA C sing N N 95 LEU CA CB sing N N 96 LEU CA HA sing N N 97 LEU C O doub N N 98 LEU C OXT sing N N 99 LEU CB CG sing N N 100 LEU CB HB2 sing N N 101 LEU CB HB3 sing N N 102 LEU CG CD1 sing N N 103 LEU CG CD2 sing N N 104 LEU CG HG sing N N 105 LEU CD1 HD11 sing N N 106 LEU CD1 HD12 sing N N 107 LEU CD1 HD13 sing N N 108 LEU CD2 HD21 sing N N 109 LEU CD2 HD22 sing N N 110 LEU CD2 HD23 sing N N 111 LEU OXT HXT sing N N 112 PHE N CA sing N N 113 PHE N H sing N N 114 PHE N H2 sing N N 115 PHE CA C sing N N 116 PHE CA CB sing N N 117 PHE CA HA sing N N 118 PHE C O doub N N 119 PHE C OXT sing N N 120 PHE CB CG sing N N 121 PHE CB HB2 sing N N 122 PHE CB HB3 sing N N 123 PHE CG CD1 doub Y N 124 PHE CG CD2 sing Y N 125 PHE CD1 CE1 sing Y N 126 PHE CD1 HD1 sing N N 127 PHE CD2 CE2 doub Y N 128 PHE CD2 HD2 sing N N 129 PHE CE1 CZ doub Y N 130 PHE CE1 HE1 sing N N 131 PHE CE2 CZ sing Y N 132 PHE CE2 HE2 sing N N 133 PHE CZ HZ sing N N 134 PHE OXT HXT sing N N 135 PRO N CA sing N N 136 PRO N CD sing N N 137 PRO N H sing N N 138 PRO CA C sing N N 139 PRO CA CB sing N N 140 PRO CA HA sing N N 141 PRO C O doub N N 142 PRO C OXT sing N N 143 PRO CB CG sing N N 144 PRO CB HB2 sing N N 145 PRO CB HB3 sing N N 146 PRO CG CD sing N N 147 PRO CG HG2 sing N N 148 PRO CG HG3 sing N N 149 PRO CD HD2 sing N N 150 PRO CD HD3 sing N N 151 PRO OXT HXT sing N N 152 SER N CA sing N N 153 SER N H sing N N 154 SER N H2 sing N N 155 SER CA C sing N N 156 SER CA CB sing N N 157 SER CA HA sing N N 158 SER C O doub N N 159 SER C OXT sing N N 160 SER CB OG sing N N 161 SER CB HB2 sing N N 162 SER CB HB3 sing N N 163 SER OG HG sing N N 164 SER OXT HXT sing N N 165 THR N CA sing N N 166 THR N H sing N N 167 THR N H2 sing N N 168 THR CA C sing N N 169 THR CA CB sing N N 170 THR CA HA sing N N 171 THR C O doub N N 172 THR C OXT sing N N 173 THR CB OG1 sing N N 174 THR CB CG2 sing N N 175 THR CB HB sing N N 176 THR OG1 HG1 sing N N 177 THR CG2 HG21 sing N N 178 THR CG2 HG22 sing N N 179 THR CG2 HG23 sing N N 180 THR OXT HXT sing N N 181 TRP N CA sing N N 182 TRP N H sing N N 183 TRP N H2 sing N N 184 TRP CA C sing N N 185 TRP CA CB sing N N 186 TRP CA HA sing N N 187 TRP C O doub N N 188 TRP C OXT sing N N 189 TRP CB CG sing N N 190 TRP CB HB2 sing N N 191 TRP CB HB3 sing N N 192 TRP CG CD1 doub Y N 193 TRP CG CD2 sing Y N 194 TRP CD1 NE1 sing Y N 195 TRP CD1 HD1 sing N N 196 TRP CD2 CE2 doub Y N 197 TRP CD2 CE3 sing Y N 198 TRP NE1 CE2 sing Y N 199 TRP NE1 HE1 sing N N 200 TRP CE2 CZ2 sing Y N 201 TRP CE3 CZ3 doub Y N 202 TRP CE3 HE3 sing N N 203 TRP CZ2 CH2 doub Y N 204 TRP CZ2 HZ2 sing N N 205 TRP CZ3 CH2 sing Y N 206 TRP CZ3 HZ3 sing N N 207 TRP CH2 HH2 sing N N 208 TRP OXT HXT sing N N 209 TYR N CA sing N N 210 TYR N H sing N N 211 TYR N H2 sing N N 212 TYR CA C sing N N 213 TYR CA CB sing N N 214 TYR CA HA sing N N 215 TYR C O doub N N 216 TYR C OXT sing N N 217 TYR CB CG sing N N 218 TYR CB HB2 sing N N 219 TYR CB HB3 sing N N 220 TYR CG CD1 doub Y N 221 TYR CG CD2 sing Y N 222 TYR CD1 CE1 sing Y N 223 TYR CD1 HD1 sing N N 224 TYR CD2 CE2 doub Y N 225 TYR CD2 HD2 sing N N 226 TYR CE1 CZ doub Y N 227 TYR CE1 HE1 sing N N 228 TYR CE2 CZ sing Y N 229 TYR CE2 HE2 sing N N 230 TYR CZ OH sing N N 231 TYR OH HH sing N N 232 TYR OXT HXT sing N N 233 VAL N CA sing N N 234 VAL N H sing N N 235 VAL N H2 sing N N 236 VAL CA C sing N N 237 VAL CA CB sing N N 238 VAL CA HA sing N N 239 VAL C O doub N N 240 VAL C OXT sing N N 241 VAL CB CG1 sing N N 242 VAL CB CG2 sing N N 243 VAL CB HB sing N N 244 VAL CG1 HG11 sing N N 245 VAL CG1 HG12 sing N N 246 VAL CG1 HG13 sing N N 247 VAL CG2 HG21 sing N N 248 VAL CG2 HG22 sing N N 249 VAL CG2 HG23 sing N N 250 VAL OXT HXT sing N N 251 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE500 Bruker 500 ? 2 'DRX-500 AVANCE800' Bruker 800 ? # _atom_sites.entry_id 1QGM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_