data_1QUB # _entry.id 1QUB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 1QUB RCSB RCSB009274 WWPDB D_1000009274 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1QUB _pdbx_database_status.recvd_initial_deposition_date 1999-07-01 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bouma, B.' 1 'de Groot, P.G.' 2 'van den Elsen, J.M.H.' 3 'Ravelli, R.B.G.' 4 'Schouten, A.' 5 'Simmelink, M.J.A.' 6 'Derksen, R.H.W.M.' 7 'Kroon, J.' 8 'Gros, P.' 9 # _citation.id primary _citation.title 'Adhesion mechanism of human beta(2)-glycoprotein I to phospholipids based on its crystal structure.' _citation.journal_abbrev 'EMBO J.' _citation.journal_volume 18 _citation.page_first 5166 _citation.page_last 5174 _citation.year 1999 _citation.journal_id_ASTM EMJODG _citation.country UK _citation.journal_id_ISSN 0261-4189 _citation.journal_id_CSD 0897 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 10508150 _citation.pdbx_database_id_DOI 10.1093/emboj/18.19.5166 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bouma, B.' 1 ? primary 'de Groot, P.G.' 2 ? primary 'van den Elsen, J.M.' 3 ? primary 'Ravelli, R.B.' 4 ? primary 'Schouten, A.' 5 ? primary 'Simmelink, M.J.' 6 ? primary 'Derksen, R.H.' 7 ? primary 'Kroon, J.' 8 ? primary 'Gros, P.' 9 ? # _cell.entry_id 1QUB _cell.length_a 161.170 _cell.length_b 166.490 _cell.length_c 114.510 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1QUB _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'PROTEIN (human beta2-Glycoprotein I)' 35478.641 1 ? ? 'BETA2-GLYCOPROTEIN I' ? 2 branched man 'alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542 1 ? ? ? ? 3 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? 5 water nat water 18.015 32 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTT FEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHA MFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPS CKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHTDASDVKPC ; _entity_poly.pdbx_seq_one_letter_code_can ;GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTT FEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHA MFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPS CKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHTDASDVKPC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ARG n 1 3 THR n 1 4 CYS n 1 5 PRO n 1 6 LYS n 1 7 PRO n 1 8 ASP n 1 9 ASP n 1 10 LEU n 1 11 PRO n 1 12 PHE n 1 13 SER n 1 14 THR n 1 15 VAL n 1 16 VAL n 1 17 PRO n 1 18 LEU n 1 19 LYS n 1 20 THR n 1 21 PHE n 1 22 TYR n 1 23 GLU n 1 24 PRO n 1 25 GLY n 1 26 GLU n 1 27 GLU n 1 28 ILE n 1 29 THR n 1 30 TYR n 1 31 SER n 1 32 CYS n 1 33 LYS n 1 34 PRO n 1 35 GLY n 1 36 TYR n 1 37 VAL n 1 38 SER n 1 39 ARG n 1 40 GLY n 1 41 GLY n 1 42 MET n 1 43 ARG n 1 44 LYS n 1 45 PHE n 1 46 ILE n 1 47 CYS n 1 48 PRO n 1 49 LEU n 1 50 THR n 1 51 GLY n 1 52 LEU n 1 53 TRP n 1 54 PRO n 1 55 ILE n 1 56 ASN n 1 57 THR n 1 58 LEU n 1 59 LYS n 1 60 CYS n 1 61 THR n 1 62 PRO n 1 63 ARG n 1 64 VAL n 1 65 CYS n 1 66 PRO n 1 67 PHE n 1 68 ALA n 1 69 GLY n 1 70 ILE n 1 71 LEU n 1 72 GLU n 1 73 ASN n 1 74 GLY n 1 75 ALA n 1 76 VAL n 1 77 ARG n 1 78 TYR n 1 79 THR n 1 80 THR n 1 81 PHE n 1 82 GLU n 1 83 TYR n 1 84 PRO n 1 85 ASN n 1 86 THR n 1 87 ILE n 1 88 SER n 1 89 PHE n 1 90 SER n 1 91 CYS n 1 92 ASN n 1 93 THR n 1 94 GLY n 1 95 PHE n 1 96 TYR n 1 97 LEU n 1 98 ASN n 1 99 GLY n 1 100 ALA n 1 101 ASP n 1 102 SER n 1 103 ALA n 1 104 LYS n 1 105 CYS n 1 106 THR n 1 107 GLU n 1 108 GLU n 1 109 GLY n 1 110 LYS n 1 111 TRP n 1 112 SER n 1 113 PRO n 1 114 GLU n 1 115 LEU n 1 116 PRO n 1 117 VAL n 1 118 CYS n 1 119 ALA n 1 120 PRO n 1 121 ILE n 1 122 ILE n 1 123 CYS n 1 124 PRO n 1 125 PRO n 1 126 PRO n 1 127 SER n 1 128 ILE n 1 129 PRO n 1 130 THR n 1 131 PHE n 1 132 ALA n 1 133 THR n 1 134 LEU n 1 135 ARG n 1 136 VAL n 1 137 TYR n 1 138 LYS n 1 139 PRO n 1 140 SER n 1 141 ALA n 1 142 GLY n 1 143 ASN n 1 144 ASN n 1 145 SER n 1 146 LEU n 1 147 TYR n 1 148 ARG n 1 149 ASP n 1 150 THR n 1 151 ALA n 1 152 VAL n 1 153 PHE n 1 154 GLU n 1 155 CYS n 1 156 LEU n 1 157 PRO n 1 158 GLN n 1 159 HIS n 1 160 ALA n 1 161 MET n 1 162 PHE n 1 163 GLY n 1 164 ASN n 1 165 ASP n 1 166 THR n 1 167 ILE n 1 168 THR n 1 169 CYS n 1 170 THR n 1 171 THR n 1 172 HIS n 1 173 GLY n 1 174 ASN n 1 175 TRP n 1 176 THR n 1 177 LYS n 1 178 LEU n 1 179 PRO n 1 180 GLU n 1 181 CYS n 1 182 ARG n 1 183 GLU n 1 184 VAL n 1 185 LYS n 1 186 CYS n 1 187 PRO n 1 188 PHE n 1 189 PRO n 1 190 SER n 1 191 ARG n 1 192 PRO n 1 193 ASP n 1 194 ASN n 1 195 GLY n 1 196 PHE n 1 197 VAL n 1 198 ASN n 1 199 TYR n 1 200 PRO n 1 201 ALA n 1 202 LYS n 1 203 PRO n 1 204 THR n 1 205 LEU n 1 206 TYR n 1 207 TYR n 1 208 LYS n 1 209 ASP n 1 210 LYS n 1 211 ALA n 1 212 THR n 1 213 PHE n 1 214 GLY n 1 215 CYS n 1 216 HIS n 1 217 ASP n 1 218 GLY n 1 219 TYR n 1 220 SER n 1 221 LEU n 1 222 ASP n 1 223 GLY n 1 224 PRO n 1 225 GLU n 1 226 GLU n 1 227 ILE n 1 228 GLU n 1 229 CYS n 1 230 THR n 1 231 LYS n 1 232 LEU n 1 233 GLY n 1 234 ASN n 1 235 TRP n 1 236 SER n 1 237 ALA n 1 238 MET n 1 239 PRO n 1 240 SER n 1 241 CYS n 1 242 LYS n 1 243 ALA n 1 244 SER n 1 245 CYS n 1 246 LYS n 1 247 VAL n 1 248 PRO n 1 249 VAL n 1 250 LYS n 1 251 LYS n 1 252 ALA n 1 253 THR n 1 254 VAL n 1 255 VAL n 1 256 TYR n 1 257 GLN n 1 258 GLY n 1 259 GLU n 1 260 ARG n 1 261 VAL n 1 262 LYS n 1 263 ILE n 1 264 GLN n 1 265 GLU n 1 266 LYS n 1 267 PHE n 1 268 LYS n 1 269 ASN n 1 270 GLY n 1 271 MET n 1 272 LEU n 1 273 HIS n 1 274 GLY n 1 275 ASP n 1 276 LYS n 1 277 VAL n 1 278 SER n 1 279 PHE n 1 280 PHE n 1 281 CYS n 1 282 LYS n 1 283 ASN n 1 284 LYS n 1 285 GLU n 1 286 LYS n 1 287 LYS n 1 288 CYS n 1 289 SER n 1 290 TYR n 1 291 THR n 1 292 GLU n 1 293 ASP n 1 294 ALA n 1 295 GLN n 1 296 CYS n 1 297 ILE n 1 298 ASP n 1 299 GLY n 1 300 THR n 1 301 ILE n 1 302 GLU n 1 303 VAL n 1 304 PRO n 1 305 LYS n 1 306 CYS n 1 307 PHE n 1 308 LYS n 1 309 GLU n 1 310 HIS n 1 311 THR n 1 312 ASP n 1 313 ALA n 1 314 SER n 1 315 ASP n 1 316 VAL n 1 317 LYS n 1 318 PRO n 1 319 CYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name human _entity_src_nat.pdbx_organism_scientific 'Homo sapiens' _entity_src_nat.pdbx_ncbi_taxonomy_id 9606 _entity_src_nat.genus Homo _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle 'BLOOD PLASMA' _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOH_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P02749 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 1QUB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 319 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02749 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 326 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose ? 'C6 H12 O6' 180.156 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 1QUB _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 8.5 _exptl_crystal.density_percent_sol 86.0 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;1.5 M ammonium sulphate 20 mM cadmium chloride 2 % (v/v) glycerol 100 mM HEPES 1.5 M AMMONIUM PHOSPHATE 100 MM SODIUM ACETATE, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type ADSC _diffrn_detector.pdbx_collection_date 1998-09-27 _diffrn_detector.details 'TOROIDAL MIRROR' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI(333)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9354 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID14-4' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID14-4 _diffrn_source.pdbx_wavelength 0.9354 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1QUB _reflns.observed_criterion_sigma_I -3.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.0 _reflns.d_resolution_high 2.7 _reflns.number_obs 42497 _reflns.number_all 42497 _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rsym_value 0.089 _reflns.pdbx_netI_over_sigmaI 5.8 _reflns.B_iso_Wilson_estimate 46.7 _reflns.pdbx_redundancy 3.8 _reflns.R_free_details ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_all 99.6 _reflns_shell.Rmerge_I_obs 0.363 _reflns_shell.pdbx_Rsym_value 0.364 _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.pdbx_redundancy 3.7 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 6122 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 1QUB _refine.ls_number_reflns_obs 42451 _refine.ls_number_reflns_all 42451 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_d_res_low 40.0 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 99.7 _refine.ls_R_factor_obs 0.25 _refine.ls_R_factor_all 0.25 _refine.ls_R_factor_R_work 0.249 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error 0.006 _refine.ls_R_factor_R_free_error_details 0.006 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_number_reflns_R_free 2082 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 51.2 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.371246 _refine.solvent_model_param_bsol 34.7939 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'Used maximum likelihood target using amplitudes' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MIRAS _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details random _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_ML ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 1QUB _refine_analyze.Luzzati_coordinate_error_obs 0.41 _refine_analyze.Luzzati_sigma_a_obs 0.39 _refine_analyze.Luzzati_d_res_low_obs 40.0 _refine_analyze.Luzzati_coordinate_error_free 0.44 _refine_analyze.Luzzati_sigma_a_free 0.37 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2480 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 95 _refine_hist.number_atoms_solvent 32 _refine_hist.number_atoms_total 2607 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 40.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d .019 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.9 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 25.3 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 1.35 ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it 1.65 1.50 ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.82 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 3.41 2.00 ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 4.80 2.50 ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 2.87 _refine_ls_shell.number_reflns_R_work 6631 _refine_ls_shell.R_factor_R_work 0.399 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.399 _refine_ls_shell.R_factor_R_free_error 0.020 _refine_ls_shell.percent_reflns_R_free 5.2 _refine_ls_shell.number_reflns_R_free 363 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 3 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' # _struct.entry_id 1QUB _struct.title 'CRYSTAL STRUCTURE OF THE GLYCOSYLATED FIVE-DOMAIN HUMAN BETA2-GLYCOPROTEIN I PURIFIED FROM BLOOD PLASMA' _struct.pdbx_descriptor 'PROTEIN (319-MER)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1QUB _struct_keywords.pdbx_keywords 'MEMBRANE ADHESION' _struct_keywords.text 'SHORT CONSENSUS REPEAT, SUSHI, COMPLEMENT CONTROL PROTEIN, N-GLYCOSYLATION, MULTI-DOMAIN, MEMBRANE ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 263 ? PHE A 267 ? ILE A 263 PHE A 267 1 ? 5 HELX_P HELX_P2 2 ASP A 312 ? VAL A 316 ? ASP A 319 VAL A 323 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 47 SG ? ? A CYS 4 A CYS 47 1_555 ? ? ? ? ? ? ? 2.098 ? ? disulf2 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 32 A CYS 60 1_555 ? ? ? ? ? ? ? 2.100 ? ? disulf3 disulf ? ? A CYS 65 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 65 A CYS 105 1_555 ? ? ? ? ? ? ? 2.076 ? ? disulf4 disulf ? ? A CYS 91 SG ? ? ? 1_555 A CYS 118 SG ? ? A CYS 91 A CYS 118 1_555 ? ? ? ? ? ? ? 2.106 ? ? disulf5 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 169 SG ? ? A CYS 123 A CYS 169 1_555 ? ? ? ? ? ? ? 2.069 ? ? disulf6 disulf ? ? A CYS 155 SG ? ? ? 1_555 A CYS 181 SG ? ? A CYS 155 A CYS 181 1_555 ? ? ? ? ? ? ? 2.113 ? ? disulf7 disulf ? ? A CYS 186 SG ? ? ? 1_555 A CYS 229 SG ? ? A CYS 186 A CYS 229 1_555 ? ? ? ? ? ? ? 2.661 ? ? disulf8 disulf ? ? A CYS 215 SG ? ? ? 1_555 A CYS 241 SG ? ? A CYS 215 A CYS 241 1_555 ? ? ? ? ? ? ? 2.107 ? ? disulf9 disulf ? ? A CYS 245 SG ? ? ? 1_555 A CYS 296 SG ? ? A CYS 245 A CYS 296 1_555 ? ? ? ? ? ? ? 2.097 ? ? disulf10 disulf ? ? A CYS 281 SG ? ? ? 1_555 A CYS 306 SG ? ? A CYS 281 A CYS 306 1_555 ? ? ? ? ? ? ? 2.088 ? ? disulf11 disulf ? ? A CYS 288 SG ? ? ? 1_555 A CYS 319 SG ? ? A CYS 288 A CYS 326 1_555 ? ? ? ? ? ? ? 2.060 ? ? covale1 covale one ? A ASN 143 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 143 A NAG 1431 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation covale2 covale one ? A ASN 164 ND2 ? ? ? 1_555 E NAG . C1 ? ? A ASN 164 A NAG 1641 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation covale3 covale one ? A ASN 174 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 174 B NAG 1 1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation covale4 covale one ? A ASN 234 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 234 C NAG 1 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation covale5 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.386 ? ? covale6 covale both ? B NAG . O4 ? ? ? 1_555 B MAN . C1 ? ? B NAG 2 B MAN 3 1_555 ? ? ? ? ? ? ? 1.416 ? ? covale7 covale both ? C NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? C NAG 1 C NAG 2 1_555 ? ? ? ? ? ? ? 1.397 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 16 A . ? VAL 16 A PRO 17 A ? PRO 17 A 1 0.66 2 TYR 83 A . ? TYR 83 A PRO 84 A ? PRO 84 A 1 -0.47 3 SER 112 A . ? SER 112 A PRO 113 A ? PRO 113 A 1 0.68 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 2 ? D ? 4 ? E ? 2 ? F ? 2 ? G ? 3 ? H ? 2 ? I ? 2 ? J ? 3 ? K ? 2 ? L ? 2 ? M ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel G 1 2 ? anti-parallel G 2 3 ? anti-parallel H 1 2 ? anti-parallel I 1 2 ? anti-parallel J 1 2 ? anti-parallel J 2 3 ? anti-parallel K 1 2 ? anti-parallel L 1 2 ? anti-parallel M 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 4 ? PRO A 5 ? CYS A 4 PRO A 5 A 2 PHE A 21 ? TYR A 22 ? PHE A 21 TYR A 22 B 1 SER A 13 ? VAL A 16 ? SER A 13 VAL A 16 B 2 GLU A 27 ? CYS A 32 ? GLU A 27 CYS A 32 B 3 ARG A 43 ? ILE A 46 ? ARG A 43 ILE A 46 C 1 TYR A 36 ? SER A 38 ? TYR A 36 SER A 38 C 2 CYS A 60 ? PRO A 62 ? CYS A 60 PRO A 62 D 1 GLY A 74 ? ARG A 77 ? GLY A 74 ARG A 77 D 2 THR A 86 ? CYS A 91 ? THR A 86 CYS A 91 D 3 SER A 102 ? CYS A 105 ? SER A 102 CYS A 105 D 4 TRP A 111 ? SER A 112 ? TRP A 111 SER A 112 E 1 PHE A 95 ? ASN A 98 ? PHE A 95 ASN A 98 E 2 VAL A 117 ? PRO A 120 ? VAL A 117 PRO A 120 F 1 ILE A 122 ? CYS A 123 ? ILE A 122 CYS A 123 F 2 SER A 145 ? LEU A 146 ? SER A 145 LEU A 146 G 1 ALA A 132 ? VAL A 136 ? ALA A 132 VAL A 136 G 2 THR A 150 ? CYS A 155 ? THR A 150 CYS A 155 G 3 THR A 166 ? THR A 168 ? THR A 166 THR A 168 H 1 HIS A 159 ? PHE A 162 ? HIS A 159 PHE A 162 H 2 GLU A 180 ? GLU A 183 ? GLU A 180 GLU A 183 I 1 LYS A 185 ? CYS A 186 ? LYS A 185 CYS A 186 I 2 LEU A 205 ? TYR A 206 ? LEU A 205 TYR A 206 J 1 GLY A 195 ? ASN A 198 ? GLY A 195 ASN A 198 J 2 LYS A 210 ? CYS A 215 ? LYS A 210 CYS A 215 J 3 GLU A 226 ? GLU A 228 ? GLU A 226 GLU A 228 K 1 TYR A 219 ? LEU A 221 ? TYR A 219 LEU A 221 K 2 CYS A 241 ? ALA A 243 ? CYS A 241 ALA A 243 L 1 THR A 253 ? VAL A 255 ? THR A 253 VAL A 255 L 2 ARG A 260 ? LYS A 262 ? ARG A 260 LYS A 262 M 1 LYS A 276 ? ASN A 283 ? LYS A 276 ASN A 283 M 2 CYS A 288 ? GLN A 295 ? CYS A 288 GLN A 295 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 4 ? O CYS A 4 N TYR A 22 ? N TYR A 22 B 1 2 O VAL A 16 ? O VAL A 16 N THR A 29 ? N THR A 29 B 2 3 N TYR A 30 ? N TYR A 30 O ARG A 43 ? O ARG A 43 C 1 2 O VAL A 37 ? O VAL A 37 N THR A 61 ? N THR A 61 D 1 2 N ARG A 77 ? N ARG A 77 O SER A 88 ? O SER A 88 D 2 3 N ILE A 87 ? N ILE A 87 O ALA A 103 ? O ALA A 103 D 3 4 N LYS A 104 ? N LYS A 104 O SER A 112 ? O SER A 112 E 1 2 N ASN A 98 ? N ASN A 98 O VAL A 117 ? O VAL A 117 F 1 2 O CYS A 123 ? O CYS A 123 N SER A 145 ? N SER A 145 G 1 2 O VAL A 136 ? O VAL A 136 N VAL A 152 ? N VAL A 152 G 2 3 O ALA A 151 ? O ALA A 151 N ILE A 167 ? N ILE A 167 H 1 2 N PHE A 162 ? N PHE A 162 O GLU A 180 ? O GLU A 180 I 1 2 N CYS A 186 ? N CYS A 186 O LEU A 205 ? O LEU A 205 J 1 2 N ASN A 198 ? N ASN A 198 O THR A 212 ? O THR A 212 J 2 3 O ALA A 211 ? O ALA A 211 N ILE A 227 ? N ILE A 227 K 1 2 O SER A 220 ? O SER A 220 N LYS A 242 ? N LYS A 242 L 1 2 N VAL A 254 ? N VAL A 254 O VAL A 261 ? O VAL A 261 M 1 2 N ASN A 283 ? N ASN A 283 O CYS A 288 ? O CYS A 288 # _database_PDB_matrix.entry_id 1QUB _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 1QUB _atom_sites.fract_transf_matrix[1][1] 0.006205 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006006 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008733 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _database_PDB_caveat.id _database_PDB_caveat.text 1 'MAN B 3 HAS WRONG CHIRALITY AT ATOM C1' 2 'NAG C 2 HAS WRONG CHIRALITY AT ATOM C1' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 CYS 47 47 47 CYS CYS A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 ARG 63 63 63 ARG ARG A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 CYS 65 65 65 CYS CYS A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 CYS 118 118 118 CYS CYS A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 PRO 120 120 120 PRO PRO A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 CYS 123 123 123 CYS CYS A . n A 1 124 PRO 124 124 124 PRO PRO A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ASN 143 143 143 ASN ASN A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 SER 145 145 145 SER SER A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 TYR 147 147 147 TYR TYR A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 CYS 155 155 155 CYS CYS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 GLN 158 158 158 GLN GLN A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 MET 161 161 161 MET MET A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 GLY 163 163 163 GLY GLY A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 THR 166 166 166 THR THR A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 THR 168 168 168 THR THR A . n A 1 169 CYS 169 169 169 CYS CYS A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 TRP 175 175 175 TRP TRP A . n A 1 176 THR 176 176 176 THR THR A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 GLU 180 180 180 GLU GLU A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 ARG 182 182 182 ARG ARG A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 CYS 186 186 186 CYS CYS A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 SER 190 190 190 SER SER A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 PRO 192 192 192 PRO PRO A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 ASN 194 194 194 ASN ASN A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 PHE 196 196 196 PHE PHE A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 PRO 200 200 200 PRO PRO A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 THR 204 204 204 THR THR A . n A 1 205 LEU 205 205 205 LEU LEU A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 TYR 207 207 207 TYR TYR A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 THR 212 212 212 THR THR A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 CYS 215 215 215 CYS CYS A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 ASP 217 217 217 ASP ASP A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 TYR 219 219 219 TYR TYR A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 GLU 225 225 225 GLU GLU A . n A 1 226 GLU 226 226 226 GLU GLU A . n A 1 227 ILE 227 227 227 ILE ILE A . n A 1 228 GLU 228 228 228 GLU GLU A . n A 1 229 CYS 229 229 229 CYS CYS A . n A 1 230 THR 230 230 230 THR THR A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 ASN 234 234 234 ASN ASN A . n A 1 235 TRP 235 235 235 TRP TRP A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 ALA 237 237 237 ALA ALA A . n A 1 238 MET 238 238 238 MET MET A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 CYS 241 241 241 CYS CYS A . n A 1 242 LYS 242 242 242 LYS LYS A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 SER 244 244 244 SER SER A . n A 1 245 CYS 245 245 245 CYS CYS A . n A 1 246 LYS 246 246 246 LYS LYS A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 PRO 248 248 248 PRO PRO A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 LYS 250 250 250 LYS LYS A . n A 1 251 LYS 251 251 251 LYS LYS A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 THR 253 253 253 THR THR A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 VAL 255 255 255 VAL VAL A . n A 1 256 TYR 256 256 256 TYR TYR A . n A 1 257 GLN 257 257 257 GLN GLN A . n A 1 258 GLY 258 258 258 GLY GLY A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 ARG 260 260 260 ARG ARG A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 LYS 262 262 262 LYS LYS A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 PHE 267 267 267 PHE PHE A . n A 1 268 LYS 268 268 268 LYS LYS A . n A 1 269 ASN 269 269 269 ASN ASN A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 MET 271 271 271 MET MET A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 HIS 273 273 273 HIS HIS A . n A 1 274 GLY 274 274 274 GLY GLY A . n A 1 275 ASP 275 275 275 ASP ASP A . n A 1 276 LYS 276 276 276 LYS LYS A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 PHE 280 280 280 PHE PHE A . n A 1 281 CYS 281 281 281 CYS CYS A . n A 1 282 LYS 282 282 282 LYS LYS A . n A 1 283 ASN 283 283 283 ASN ASN A . n A 1 284 LYS 284 284 284 LYS LYS A . n A 1 285 GLU 285 285 285 GLU GLU A . n A 1 286 LYS 286 286 286 LYS LYS A . n A 1 287 LYS 287 287 287 LYS LYS A . n A 1 288 CYS 288 288 288 CYS CYS A . n A 1 289 SER 289 289 289 SER SER A . n A 1 290 TYR 290 290 290 TYR TYR A . n A 1 291 THR 291 291 291 THR THR A . n A 1 292 GLU 292 292 292 GLU GLU A . n A 1 293 ASP 293 293 293 ASP ASP A . n A 1 294 ALA 294 294 294 ALA ALA A . n A 1 295 GLN 295 295 295 GLN GLN A . n A 1 296 CYS 296 296 296 CYS CYS A . n A 1 297 ILE 297 297 297 ILE ILE A . n A 1 298 ASP 298 298 298 ASP ASP A . n A 1 299 GLY 299 299 299 GLY GLY A . n A 1 300 THR 300 300 300 THR THR A . n A 1 301 ILE 301 301 301 ILE ILE A . n A 1 302 GLU 302 302 302 GLU GLU A . n A 1 303 VAL 303 303 303 VAL VAL A . n A 1 304 PRO 304 304 304 PRO PRO A . n A 1 305 LYS 305 305 305 LYS LYS A . n A 1 306 CYS 306 306 306 CYS CYS A . n A 1 307 PHE 307 307 307 PHE PHE A . n A 1 308 LYS 308 308 308 LYS LYS A . n A 1 309 GLU 309 309 309 GLU GLU A . n A 1 310 HIS 310 310 310 HIS HIS A . n A 1 311 THR 311 318 318 THR THR A . n A 1 312 ASP 312 319 319 ASP ASP A . n A 1 313 ALA 313 320 320 ALA ALA A . n A 1 314 SER 314 321 321 SER SER A . n A 1 315 ASP 315 322 322 ASP ASP A . n A 1 316 VAL 316 323 323 VAL VAL A . n A 1 317 LYS 317 324 324 LYS LYS A . n A 1 318 PRO 318 325 325 PRO PRO A . n A 1 319 CYS 319 326 326 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 NAG 1 1431 1431 NAG NAG A . E 4 NAG 1 1641 1641 NAG NAG A . F 5 HOH 1 602 602 HOH WAT A . F 5 HOH 2 605 605 HOH WAT A . F 5 HOH 3 606 606 HOH WAT A . F 5 HOH 4 607 607 HOH WAT A . F 5 HOH 5 610 610 HOH WAT A . F 5 HOH 6 612 612 HOH WAT A . F 5 HOH 7 614 614 HOH WAT A . F 5 HOH 8 615 615 HOH WAT A . F 5 HOH 9 618 618 HOH WAT A . F 5 HOH 10 619 619 HOH WAT A . F 5 HOH 11 623 623 HOH WAT A . F 5 HOH 12 624 624 HOH WAT A . F 5 HOH 13 628 628 HOH WAT A . F 5 HOH 14 629 629 HOH WAT A . F 5 HOH 15 631 631 HOH WAT A . F 5 HOH 16 633 633 HOH WAT A . F 5 HOH 17 634 634 HOH WAT A . F 5 HOH 18 635 635 HOH WAT A . F 5 HOH 19 637 637 HOH WAT A . F 5 HOH 20 640 640 HOH WAT A . F 5 HOH 21 643 643 HOH WAT A . F 5 HOH 22 645 645 HOH WAT A . F 5 HOH 23 648 648 HOH WAT A . F 5 HOH 24 649 649 HOH WAT A . F 5 HOH 25 657 657 HOH WAT A . F 5 HOH 26 663 663 HOH WAT A . F 5 HOH 27 666 666 HOH WAT A . F 5 HOH 28 674 674 HOH WAT A . F 5 HOH 29 675 675 HOH WAT A . F 5 HOH 30 679 679 HOH WAT A . F 5 HOH 31 687 687 HOH WAT A . F 5 HOH 32 688 688 HOH WAT A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A ASN 143 A ASN 143 ? ASN 'GLYCOSYLATION SITE' 2 A ASN 164 A ASN 164 ? ASN 'GLYCOSYLATION SITE' 3 A ASN 174 A ASN 174 ? ASN 'GLYCOSYLATION SITE' 4 A ASN 234 A ASN 234 ? ASN 'GLYCOSYLATION SITE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-10-08 2 'Structure model' 1 1 2008-04-27 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-01-24 5 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 5 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Non-polymer description' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' Advisory 6 5 'Structure model' 'Atomic model' 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 5 'Structure model' atom_site 3 5 'Structure model' chem_comp 4 5 'Structure model' database_PDB_caveat 5 5 'Structure model' entity 6 5 'Structure model' pdbx_branch_scheme 7 5 'Structure model' pdbx_chem_comp_identifier 8 5 'Structure model' pdbx_entity_branch 9 5 'Structure model' pdbx_entity_branch_descriptor 10 5 'Structure model' pdbx_entity_branch_link 11 5 'Structure model' pdbx_entity_branch_list 12 5 'Structure model' pdbx_entity_nonpoly 13 5 'Structure model' pdbx_nonpoly_scheme 14 5 'Structure model' pdbx_struct_assembly_gen 15 5 'Structure model' pdbx_validate_chiral 16 5 'Structure model' struct_asym 17 5 'Structure model' struct_conn 18 5 'Structure model' struct_site 19 5 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.name' 2 5 'Structure model' '_atom_site.B_iso_or_equiv' 3 5 'Structure model' '_atom_site.Cartn_x' 4 5 'Structure model' '_atom_site.Cartn_y' 5 5 'Structure model' '_atom_site.Cartn_z' 6 5 'Structure model' '_atom_site.auth_asym_id' 7 5 'Structure model' '_atom_site.auth_atom_id' 8 5 'Structure model' '_atom_site.auth_comp_id' 9 5 'Structure model' '_atom_site.auth_seq_id' 10 5 'Structure model' '_atom_site.label_asym_id' 11 5 'Structure model' '_atom_site.label_atom_id' 12 5 'Structure model' '_atom_site.label_comp_id' 13 5 'Structure model' '_atom_site.label_entity_id' 14 5 'Structure model' '_atom_site.type_symbol' 15 5 'Structure model' '_chem_comp.name' 16 5 'Structure model' '_chem_comp.type' 17 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 5 'Structure model' '_pdbx_validate_chiral.auth_asym_id' 19 5 'Structure model' '_pdbx_validate_chiral.auth_seq_id' 20 5 'Structure model' '_struct_conn.pdbx_dist_value' 21 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 22 5 'Structure model' '_struct_conn.pdbx_role' 23 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 24 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 31 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MOSFLM 'data reduction' . ? 1 TRUNCATE 'data reduction' . ? 2 SOLVE phasing . ? 3 CNS refinement . ? 4 CCP4 'data scaling' '(TRUNCATE)' ? 5 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 10 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 11 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CA _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 11 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.06 _pdbx_validate_rmsd_angle.angle_target_value 119.30 _pdbx_validate_rmsd_angle.angle_deviation 9.76 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.50 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 11 ? ? -15.30 -62.29 2 1 PHE A 81 ? ? -101.59 49.92 3 1 PRO A 113 ? ? -69.38 -172.69 4 1 PHE A 131 ? ? -109.17 50.10 5 1 ARG A 135 ? ? -78.55 -73.00 6 1 ALA A 141 ? ? -172.94 86.89 7 1 ARG A 148 ? ? 79.93 -7.41 8 1 PRO A 200 ? ? -33.79 141.17 9 1 ALA A 201 ? ? -73.98 42.95 10 1 LYS A 208 ? ? 75.03 -9.03 11 1 ALA A 252 ? ? -177.54 144.96 12 1 ASN A 269 ? ? -98.13 31.24 13 1 GLU A 285 ? ? -63.76 -73.79 14 1 ASP A 319 ? ? 61.23 108.61 # loop_ _pdbx_validate_chiral.id _pdbx_validate_chiral.PDB_model_num _pdbx_validate_chiral.auth_atom_id _pdbx_validate_chiral.label_alt_id _pdbx_validate_chiral.auth_asym_id _pdbx_validate_chiral.auth_comp_id _pdbx_validate_chiral.auth_seq_id _pdbx_validate_chiral.PDB_ins_code _pdbx_validate_chiral.details _pdbx_validate_chiral.omega 1 1 C1 ? B MAN 3 ? 'WRONG HAND' . 2 1 C1 ? C NAG 2 ? 'WRONG HAND' . # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 HIS _pdbx_validate_polymer_linkage.auth_seq_id_1 310 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 ? _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 THR _pdbx_validate_polymer_linkage.auth_seq_id_2 318 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 ? _pdbx_validate_polymer_linkage.dist 9.78 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 ? NAG 1741 n B 2 NAG 2 B NAG 2 ? NAG 1742 n B 2 MAN 3 B MAN 3 ? MAN 1743 n C 3 NAG 1 C NAG 1 ? NAG 2341 n C 3 NAG 2 C NAG 2 ? NAG 2342 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DManpa MAN 'COMMON NAME' GMML 1.0 a-D-mannopyranose MAN 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 a-D-Manp MAN 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Man NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_entity_branch.entity_id _pdbx_entity_branch.type 2 oligosaccharide 3 oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DManpa1-4DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1a_1-5]/1-1-2/a4-b1_b4-c1' WURCS PDB2Glycan 1.1.0 3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}' LINUCS PDB-CARE ? 4 3 DGlcpNAcb1-4DGlcpNAcb1- 'Glycam Condensed Sequence' GMML 1.0 5 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][a-D-GlcpNAc]{}}}' LINUCS PDB-CARE ? # loop_ _pdbx_entity_branch_link.link_id _pdbx_entity_branch_link.entity_id _pdbx_entity_branch_link.entity_branch_list_num_1 _pdbx_entity_branch_link.comp_id_1 _pdbx_entity_branch_link.atom_id_1 _pdbx_entity_branch_link.leaving_atom_id_1 _pdbx_entity_branch_link.entity_branch_list_num_2 _pdbx_entity_branch_link.comp_id_2 _pdbx_entity_branch_link.atom_id_2 _pdbx_entity_branch_link.leaving_atom_id_2 _pdbx_entity_branch_link.value_order _pdbx_entity_branch_link.details 1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 2 2 3 MAN C1 O1 2 NAG O4 HO4 sing ? 3 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n 2 MAN 3 n 3 NAG 1 n 3 NAG 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 5 water HOH #