data_1QUW
# 
_entry.id   1QUW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1QUW         pdb_00001quw 10.2210/pdb1quw/pdb 
RCSB  RCSB009284   ?            ?                   
WWPDB D_1000009284 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-26 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2022-03-02 
5 'Structure model' 1 4 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                
2 4 'Structure model' pdbx_nmr_software         
3 4 'Structure model' pdbx_struct_assembly      
4 4 'Structure model' pdbx_struct_oper_list     
5 5 'Structure model' chem_comp_atom            
6 5 'Structure model' chem_comp_bond            
7 5 'Structure model' pdbx_entry_details        
8 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_pdbx_nmr_software.name'             
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1QUW 
_pdbx_database_status.recvd_initial_deposition_date   1999-07-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nicastro, G.'  1 
'de Chiara, C.' 2 
'Pedone, E.'    3 
'Tato, M.'      4 
'Rossi, M.'     5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'NMR solution structure of a novel thioredoxin from Bacillus acidocaldarius possible determinants of protein stability.' 
Eur.J.Biochem.       267 403 413 2000 EJBCAI IX 0014-2956 0262 ? 10632710 10.1046/j.1432-1327.2000.01015.x 
1       'Thioredoxin from Bacillus Acidocaldarius: Characterization, High-Level Expression in E. Coli and Molecular Modeling'    
Biochem.J.           328 277 285 1997 BIJOAK UK 0264-6021 0043 ? ?        ?                                
2       'Computational Analysis of the Thermal Stability in Thioredoxins: a Molecular Dynamics Approach'                         
J.Biomol.Struct.Dyn. 16  437 446 1998 JBSDD6 US 0739-1102 0646 ? ?        ?                                
3       'Prediction and Experimental Testing of the Bacillus acidocaldarius Thioredoxin Stability'                               
Biochem.J.           339 309 317 1999 BIJOAK UK 0264-6021 0043 ? ?        10.1042/0264-6021:3390309        
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nicastro, G.'   1  ? 
primary 'De Chiara, C.'  2  ? 
primary 'Pedone, E.'     3  ? 
primary 'Tato, M.'       4  ? 
primary 'Rossi, M.'      5  ? 
primary 'Bartolucci, S.' 6  ? 
1       'Bartolucci, S.' 7  ? 
1       'Guagliardi, A.' 8  ? 
1       'Pedone, E.'     9  ? 
1       'De Pascale, D.' 10 ? 
1       'Cannio, R.'     11 ? 
1       'Camardella, L.' 12 ? 
1       'Rossi, M.'      13 ? 
1       'Nicastro, G.'   14 ? 
1       'de Chiara, C.'  15 ? 
1       'Facci, P.'      16 ? 
1       'Mascetti, G.'   17 ? 
1       'Nicolini, C.'   18 ? 
2       'Pedone, E.M.'   19 ? 
2       'Bartolucci, S.' 20 ? 
2       'Rossi, M.'      21 ? 
2       'Saviano, M.'    22 ? 
3       'Pedone, E.'     23 ? 
3       'Cannio, R.'     24 ? 
3       'Saviano, M.'    25 ? 
3       'Rossi, M.'      26 ? 
3       'Bartolucci, S.' 27 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           THIOREDOXIN 
_entity.formula_weight             11585.291 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKG
GRPVKQLIGYQPKEQLEAQLADVLQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKG
GRPVKQLIGYQPKEQLEAQLADVLQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   MET n 
1 4   THR n 
1 5   LEU n 
1 6   THR n 
1 7   ASP n 
1 8   ALA n 
1 9   ASN n 
1 10  PHE n 
1 11  GLN n 
1 12  GLN n 
1 13  ALA n 
1 14  ILE n 
1 15  GLN n 
1 16  GLY n 
1 17  ASP n 
1 18  LYS n 
1 19  PRO n 
1 20  VAL n 
1 21  LEU n 
1 22  VAL n 
1 23  ASP n 
1 24  PHE n 
1 25  TRP n 
1 26  ALA n 
1 27  ALA n 
1 28  TRP n 
1 29  CYS n 
1 30  GLY n 
1 31  PRO n 
1 32  CYS n 
1 33  ARG n 
1 34  MET n 
1 35  MET n 
1 36  ALA n 
1 37  PRO n 
1 38  VAL n 
1 39  LEU n 
1 40  GLU n 
1 41  GLU n 
1 42  PHE n 
1 43  ALA n 
1 44  GLU n 
1 45  ALA n 
1 46  HIS n 
1 47  ALA n 
1 48  ASP n 
1 49  LYS n 
1 50  VAL n 
1 51  THR n 
1 52  VAL n 
1 53  ALA n 
1 54  LYS n 
1 55  LEU n 
1 56  ASN n 
1 57  VAL n 
1 58  ASP n 
1 59  GLU n 
1 60  ASN n 
1 61  PRO n 
1 62  GLU n 
1 63  THR n 
1 64  THR n 
1 65  SER n 
1 66  GLN n 
1 67  PHE n 
1 68  GLY n 
1 69  ILE n 
1 70  MET n 
1 71  SER n 
1 72  ILE n 
1 73  PRO n 
1 74  THR n 
1 75  LEU n 
1 76  ILE n 
1 77  LEU n 
1 78  PHE n 
1 79  LYS n 
1 80  GLY n 
1 81  GLY n 
1 82  ARG n 
1 83  PRO n 
1 84  VAL n 
1 85  LYS n 
1 86  GLN n 
1 87  LEU n 
1 88  ILE n 
1 89  GLY n 
1 90  TYR n 
1 91  GLN n 
1 92  PRO n 
1 93  LYS n 
1 94  GLU n 
1 95  GLN n 
1 96  LEU n 
1 97  GLU n 
1 98  ALA n 
1 99  GLN n 
1 100 LEU n 
1 101 ALA n 
1 102 ASP n 
1 103 VAL n 
1 104 LEU n 
1 105 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Alicyclobacillus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Alicyclobacillus acidocaldarius' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     405212 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PTRC99A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   BACTERIUM 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   MET 3   3   3   MET MET A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   ASP 7   7   7   ASP ASP A . n 
A 1 8   ALA 8   8   8   ALA ALA A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  GLN 12  12  12  GLN GLN A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  TRP 25  25  25  TRP TRP A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  CYS 29  29  29  CYS CYS A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  CYS 32  32  32  CYS CYS A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  MET 34  34  34  MET MET A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  ALA 43  43  43  ALA ALA A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  MET 70  70  70  MET MET A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  ARG 82  82  82  ARG ARG A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  GLN 86  86  86  GLN GLN A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  GLN 95  95  95  GLN GLN A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
# 
_cell.entry_id           1QUW 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1QUW 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_exptl.entry_id          1QUW 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_database_PDB_matrix.entry_id          1QUW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1QUW 
_struct.title                     'SOLUTION STRUCTURE OF THE THIOREDOXIN FROM BACILLUS ACIDOCALDARIUS' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1QUW 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ALPHA/BETA OPEN-TWISTED PROTEIN, THIOL-DISULFIDE, ELECTRON TRANSPORT' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    THIO_ALIAC 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P80579 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1QUW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 105 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P80579 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  105 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       105 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 6  ? GLN A 15  ? THR A 6  GLN A 15  1 ? 10 
HELX_P HELX_P2 2 PRO A 31 ? HIS A 46  ? PRO A 31 HIS A 46  1 ? 16 
HELX_P HELX_P3 3 PRO A 61 ? GLY A 68  ? PRO A 61 GLY A 68  1 ? 8  
HELX_P HELX_P4 4 PRO A 92 ? GLN A 105 ? PRO A 92 GLN A 105 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            29 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            32 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             29 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             32 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.997 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       29 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      32 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        29 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       32 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 1  2.21 
2  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 2  3.33 
3  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 3  4.30 
4  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 4  2.99 
5  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 5  1.23 
6  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 6  4.67 
7  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 7  5.55 
8  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 8  2.93 
9  ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 9  4.95 
10 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 10 1.19 
11 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 11 3.11 
12 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 12 5.72 
13 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 13 5.39 
14 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 14 7.97 
15 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 15 4.86 
16 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 16 2.56 
17 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 17 2.67 
18 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 18 6.27 
19 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 19 2.80 
20 ILE 72 A . ? ILE 72 A PRO 73 A ? PRO 73 A 20 1.37 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 52 ? ASN A 56 ? VAL A 52 ASN A 56 
A 2 VAL A 20 ? TRP A 25 ? VAL A 20 TRP A 25 
A 3 THR A 74 ? PHE A 78 ? THR A 74 PHE A 78 
A 4 PRO A 83 ? ILE A 88 ? PRO A 83 ILE A 88 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 53 ? N ALA A 53 O LEU A 21 ? O LEU A 21 
A 2 3 N PHE A 24 ? N PHE A 24 O THR A 74 ? O THR A 74 
A 3 4 O LEU A 77 ? O LEU A 77 N VAL A 84 ? N VAL A 84 
# 
_pdbx_entry_details.entry_id                   1QUW 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1  O A THR 6  ? ? H A PHE 10 ? ? 1.59 
2 5  O A THR 6  ? ? H A PHE 10 ? ? 1.60 
3 8  O A THR 6  ? ? H A PHE 10 ? ? 1.58 
4 12 O A THR 6  ? ? H A PHE 10 ? ? 1.51 
5 12 O A LEU 77 ? ? H A VAL 84 ? ? 1.57 
6 13 O A THR 6  ? ? H A PHE 10 ? ? 1.59 
7 14 O A THR 6  ? ? H A PHE 10 ? ? 1.53 
8 18 O A THR 6  ? ? H A PHE 10 ? ? 1.59 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.410 1.354 0.056 0.009 N 
2  2  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.408 1.354 0.054 0.009 N 
3  4  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
4  5  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.412 1.354 0.058 0.009 N 
5  6  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.410 1.354 0.056 0.009 N 
6  7  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.411 1.354 0.057 0.009 N 
7  8  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
8  9  CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.408 1.354 0.054 0.009 N 
9  10 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.410 1.354 0.056 0.009 N 
10 11 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.408 1.354 0.054 0.009 N 
11 12 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.411 1.354 0.057 0.009 N 
12 13 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
13 14 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.410 1.354 0.056 0.009 N 
14 15 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
15 18 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
16 19 CG A HIS 46 ? ? CD2 A HIS 46 ? ? 1.409 1.354 0.055 0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.46 111.50 7.96 1.30 N 
2  2  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.39 111.50 7.89 1.30 N 
3  4  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.40 111.50 7.90 1.30 N 
4  5  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.43 111.50 7.93 1.30 N 
5  6  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.40 111.50 7.90 1.30 N 
6  7  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.36 111.50 7.86 1.30 N 
7  8  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.36 111.50 7.86 1.30 N 
8  9  ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.37 111.50 7.87 1.30 N 
9  10 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.33 111.50 7.83 1.30 N 
10 11 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.41 111.50 7.91 1.30 N 
11 12 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.42 111.50 7.92 1.30 N 
12 13 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.39 111.50 7.89 1.30 N 
13 14 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.35 111.50 7.85 1.30 N 
14 15 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.35 111.50 7.85 1.30 N 
15 16 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.33 111.50 7.83 1.30 N 
16 17 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.46 111.50 7.96 1.30 N 
17 18 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.37 111.50 7.87 1.30 N 
18 19 ND1 A HIS 46 ? ? CE1 A HIS 46 ? ? NE2 A HIS 46 ? ? 119.45 111.50 7.95 1.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ASP A 7  ? ? -24.91  -56.97  
2   1  ASP A 17 ? ? -172.38 84.67   
3   1  ALA A 47 ? ? 69.96   -70.05  
4   1  ASP A 48 ? ? -87.50  35.12   
5   1  LYS A 49 ? ? -153.64 -48.30  
6   2  ASP A 17 ? ? -162.57 -51.39  
7   2  ALA A 47 ? ? 68.54   -83.81  
8   2  ASP A 48 ? ? -87.42  37.45   
9   2  LYS A 49 ? ? -145.11 -42.13  
10  2  LYS A 79 ? ? -91.92  -71.35  
11  2  ARG A 82 ? ? -161.68 118.10  
12  2  PRO A 92 ? ? -49.11  166.86  
13  3  ASP A 17 ? ? -158.34 -65.72  
14  3  ALA A 47 ? ? 63.63   -92.90  
15  3  PRO A 92 ? ? -57.97  171.48  
16  4  ASP A 7  ? ? -25.93  -54.42  
17  4  ASP A 17 ? ? -166.88 -60.67  
18  4  ALA A 47 ? ? 60.91   -88.05  
19  4  ASP A 48 ? ? -79.11  43.04   
20  4  LYS A 49 ? ? -153.49 -56.88  
21  4  LYS A 79 ? ? -110.49 -75.05  
22  4  PRO A 92 ? ? -48.81  158.03  
23  5  ASP A 17 ? ? -164.60 -46.90  
24  5  ALA A 47 ? ? 68.86   -74.72  
25  5  LYS A 49 ? ? -142.00 -46.62  
26  5  LYS A 79 ? ? -100.31 -76.49  
27  5  PRO A 92 ? ? -53.49  172.27  
28  6  ASP A 17 ? ? -167.55 -67.09  
29  6  ALA A 47 ? ? 66.99   -85.41  
30  6  ASP A 48 ? ? -84.92  36.07   
31  6  LYS A 49 ? ? -148.05 -35.67  
32  7  ASP A 17 ? ? -165.14 -50.35  
33  7  ALA A 47 ? ? 68.29   -83.43  
34  7  ASP A 48 ? ? -79.03  32.67   
35  7  LYS A 49 ? ? -154.16 -45.18  
36  7  SER A 71 ? ? -163.64 119.42  
37  7  LYS A 79 ? ? -130.47 -72.92  
38  7  PRO A 92 ? ? -47.74  164.20  
39  8  ASP A 17 ? ? -165.16 -57.21  
40  8  ALA A 47 ? ? 71.04   -69.41  
41  8  LYS A 49 ? ? -145.35 -40.70  
42  8  SER A 71 ? ? -170.42 127.45  
43  8  LYS A 79 ? ? -94.83  -76.03  
44  9  ASP A 17 ? ? -159.33 -69.52  
45  9  ALA A 47 ? ? 69.43   -79.65  
46  9  LYS A 49 ? ? -141.29 -40.89  
47  9  LYS A 79 ? ? -106.47 -75.11  
48  10 ASP A 17 ? ? -164.10 -59.28  
49  10 ALA A 47 ? ? 65.74   -82.81  
50  10 ASP A 48 ? ? -85.90  36.19   
51  10 LYS A 49 ? ? -146.83 -39.57  
52  10 LYS A 79 ? ? -106.62 -68.38  
53  10 PRO A 92 ? ? -57.79  171.47  
54  11 ASP A 17 ? ? -159.24 -58.81  
55  11 ALA A 47 ? ? 66.22   -84.75  
56  11 ASP A 48 ? ? -81.80  35.29   
57  11 LYS A 49 ? ? -144.91 -44.26  
58  11 LYS A 79 ? ? -106.65 -67.29  
59  11 PRO A 92 ? ? -58.04  172.66  
60  12 ASP A 17 ? ? -147.89 -53.34  
61  12 ALA A 47 ? ? 73.32   -81.33  
62  12 LYS A 79 ? ? -92.71  -75.20  
63  12 ARG A 82 ? ? -170.97 126.68  
64  12 PRO A 92 ? ? -53.03  171.90  
65  13 ASP A 17 ? ? -169.51 -46.59  
66  13 ALA A 47 ? ? 71.56   -98.41  
67  13 SER A 71 ? ? 174.50  128.11  
68  13 PRO A 92 ? ? -55.90  173.97  
69  14 ASP A 17 ? ? -169.52 -50.00  
70  14 PRO A 19 ? ? -38.54  124.78  
71  14 ALA A 47 ? ? 70.93   -78.90  
72  14 ASP A 48 ? ? -84.95  44.66   
73  14 LYS A 49 ? ? -152.22 -51.65  
74  14 SER A 71 ? ? -161.65 70.75   
75  14 LYS A 79 ? ? -138.08 -66.02  
76  15 ASP A 17 ? ? -165.98 -53.47  
77  15 ALA A 47 ? ? 71.38   -83.84  
78  15 ASP A 48 ? ? -83.30  34.02   
79  15 LYS A 49 ? ? -143.49 -48.26  
80  15 LYS A 79 ? ? -101.56 -84.00  
81  15 PRO A 92 ? ? -46.82  163.19  
82  16 ASP A 17 ? ? -157.03 -71.60  
83  16 ALA A 47 ? ? 66.16   -82.69  
84  16 ASP A 48 ? ? -83.60  38.76   
85  16 LYS A 49 ? ? -149.96 -47.81  
86  16 LYS A 79 ? ? -104.30 -68.47  
87  16 PRO A 92 ? ? -54.77  170.04  
88  17 LYS A 18 ? ? -68.47  -175.75 
89  17 PRO A 19 ? ? -39.84  123.17  
90  17 ALA A 47 ? ? 66.36   -85.62  
91  17 LYS A 49 ? ? -133.07 -38.31  
92  17 LYS A 79 ? ? -106.18 -71.38  
93  18 ASP A 17 ? ? -165.03 -63.18  
94  18 ALA A 47 ? ? 71.54   -79.13  
95  18 ASP A 48 ? ? -83.95  30.69   
96  18 LYS A 49 ? ? -137.57 -44.79  
97  18 LYS A 79 ? ? -103.84 -85.54  
98  19 ASP A 17 ? ? -169.08 -46.29  
99  19 ALA A 47 ? ? 67.10   -82.90  
100 19 LYS A 79 ? ? -97.37  -76.18  
101 19 PRO A 92 ? ? -58.14  173.00  
102 20 ASP A 17 ? ? -165.33 -54.93  
103 20 ALA A 47 ? ? 66.08   -95.42  
104 20 SER A 71 ? ? -146.33 58.41   
105 20 LYS A 79 ? ? -98.52  -66.50  
# 
_pdbx_nmr_ensemble.entry_id                                      1QUW 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
;STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY,STRUCTURES WITH THE LEAST 
RESTRAINT VIOLATIONS
;
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.2MM RECOMBINANT THIOREDOXIN FROM BACILLUS ACIDOCALDARIUS; 50MM PHOSPHATE 
BUFFER NA; 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   ? 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 300 AMBIENT 5.8 '50mM BUFFER PHOSPHATE' ? K 
2 308 AMBIENT 5.8 '50mM BUFFER PHOSPHATE' ? K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 DQF-COSY   1 
2 1 '2D NOESY' 1 
3 1 TOCSY      1 
4 2 DQF-COSY   1 
5 2 '2D NOESY' 1 
6 2 TOCSY      1 
# 
_pdbx_nmr_details.entry_id   1QUW 
_pdbx_nmr_details.text       'THIS STRUCTURE WAS DETERMINED USING STANDARD 2D AND 3D HOMONUCLEAR TECHNIQUES.' 
# 
_pdbx_nmr_refine.entry_id           1QUW 
_pdbx_nmr_refine.method             
;SIMULATED ANNEALING, RESTRAINED MOLECULAR DYNAMICS AND RESTRAINED ENERGY 
MINIMISATION
;
_pdbx_nmr_refine.details            
;THE STRUCTURE ARE BASED ON A TOTAL OF 2276 NOE-DERIVED DISTANCE CONSTRAINTS, 
99 DIHEDRAL ANGLE RESTRAINTS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           VNMR     4.1     VARIAN     1 
'data analysis'      Felix    FELIX95 'HARE, D.' 2 
'structure solution' Discover 95      BIOSYM     3 
refinement           Discover 95      BIOSYM     4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
TYR N    N N N 345 
TYR CA   C N S 346 
TYR C    C N N 347 
TYR O    O N N 348 
TYR CB   C N N 349 
TYR CG   C Y N 350 
TYR CD1  C Y N 351 
TYR CD2  C Y N 352 
TYR CE1  C Y N 353 
TYR CE2  C Y N 354 
TYR CZ   C Y N 355 
TYR OH   O N N 356 
TYR OXT  O N N 357 
TYR H    H N N 358 
TYR H2   H N N 359 
TYR HA   H N N 360 
TYR HB2  H N N 361 
TYR HB3  H N N 362 
TYR HD1  H N N 363 
TYR HD2  H N N 364 
TYR HE1  H N N 365 
TYR HE2  H N N 366 
TYR HH   H N N 367 
TYR HXT  H N N 368 
VAL N    N N N 369 
VAL CA   C N S 370 
VAL C    C N N 371 
VAL O    O N N 372 
VAL CB   C N N 373 
VAL CG1  C N N 374 
VAL CG2  C N N 375 
VAL OXT  O N N 376 
VAL H    H N N 377 
VAL H2   H N N 378 
VAL HA   H N N 379 
VAL HB   H N N 380 
VAL HG11 H N N 381 
VAL HG12 H N N 382 
VAL HG13 H N N 383 
VAL HG21 H N N 384 
VAL HG22 H N N 385 
VAL HG23 H N N 386 
VAL HXT  H N N 387 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             UNITY 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_atom_sites.entry_id                    1QUW 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_